Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18210-AT4G36500
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.8402214918211
Log2 mRNA fold difference:3.8034564845706
Log2 TE fold difference:-0.81020712692998
Sequences
Protein sequence

MQMLRNLSTRTRSRRGGYERVSDDSTFSLLGAKLRRSTSVPYYAPSIRLGGDFPVILEKL
PRQKPTKTVVTSKLSHPIFSLFDGYRRHNKKKATAKPEFSRYHEYLKESGMWDLRSNSPV
IYFK

MQMLRSLSTRTRSRRGGYERVSDDSTFSLLGAKLRRSTSVPYYAPSIKLGAGGVPTILEE
LPRQKSKKVKPTGKFSHPIFSLFYGKKKKSTTTKPEFSRYLEYLKEGGMWDARANAPVIY
YK

Other information
Ka divergence:0.0418063KaKs divergence:-0.999943
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):375Length 2 (bp):369Length divergence:-0.008
MFE 1 (kcal):-112.5MFE 2 (kcal):-102.5MFE divergence-0.047