Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18300-AT4G36540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):basic helix-loop-helix (bHLH) DNA-binding superfamily protein
Function (paralog2):BR enhanced expression 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.35067844140967
Log2 mRNA fold difference:-0.46607814942266
Log2 TE fold difference:0.050051822121587
Sequences
Protein sequence

MLEGLVSQESLSLNSMDMSVLERLKWVQQQQQQLQQVVSHSSNNSPELLQILQFHGSNND
ELLESSFSQFQMLGSGFGPNYNMGFGPPHESISRTSSCHMEPVDTMEVLLKTGEETRAVA
LKNKRKPEVKTREEQKTEKKIKVEAETESSMKGKSNMGNTEASSDTSKETSKGASENQKL
DYIHVRARRGQATDRHSLAERARREKISKKMKYLQDIVPGCNKVTGKAGMLDEIINYVQC
LQRQVEFLSMKLAVLNPELELAVEDVSVKQFQAYFTNVVASKQSIMVDVPLFPLDQQGSL
DLSAINPNQTTSIEAPSGSWETQSQSLYNTSSLENSCGNYNKISKILLSTKCTHQYVPIR
RVWV

MDLSVLDRLKWLQQQQMVSPEFLQILGSDGREELKRVESYLGNNNDELQSFRHFPEFGPD
YDTTDGCISRTSSFHMEPVKNNGHSRAITLQNKRKPEGKTEKREKKKIKAEDETEPSMKG
KSNMSNTETSSEIQKPDYIHVRARRGEATDRHSLAERARREKISKKMKCLQDIVPGCNKV
TGKAGMLDEIINYVQSLQQQVEFLSMKLSVINPELECHIDDLSAKQFQAYFTGPPEGDSK
QSIMADFRSFPLHQQGSLDYSVINSDHTTSLGAKDHTSSSWETHSQCLYNSLRTDSVSNF
FSLK

www.000webhost.com

Other information
Ka divergence:0.127108KaKs divergence:0.389093
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1095Length 2 (bp):915Length divergence:-0.09
MFE 1 (kcal):-302.72MFE 2 (kcal):-242.8MFE divergence-0.11