Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18330-AT4G36580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):AAA-type ATPase family protein
Function (paralog2):AAA-type ATPase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.52616762165966
Log2 mRNA fold difference:-0.82258830413911
Log2 TE fold difference:0.253310843104
Sequences
Protein sequence

MAASRLCSAAAIAAAFTSMSMSQNRAYADSRFRFPFFSSSPPAEESPTDHKSSSNSKSET
KPDSDEPKGSGFDPESLERGAKALREINSSPHSKQVFDLMRKQEKTRLAELAAEKEHNEA
IQASKDIERQRKLAEDQRNLVQQQAQAKAQNLRYEDELARKRMQTDNEAQRRHNAELVSM
QEASSIRKEKARIATEEQIQAQQRETEKERAELERETIRVKAMAEAEGRAHEAKLTEEQN
RRMLLDKINGEREKWLAAINTTFSHIEGGVRTLLTDRSKLIMTVGGVTALAAGVYTTREG
ARVTWGYINRILGQPSLIRESSMGRFPWAGSVSQFKNKLSTAAGAAASAEGEKPLENVIL
HRSLKTRIERLARATANTKSHKAPFRNMMFYGPPGTGKTMVAREIARKSGLDYAMMTGGD
VAPLGAQAVTKIHEIFDWAKKSNKGLLLFIDEADAFLCERNSTYMSEAQRSALNALLFRT
GDQSRDIVLVLATNRPGDLDSAVTDRIDEVIEFPLPGEEERFKLLKLYLNKYLMGDDKKG
EKDSNLKWSNLFKKKKSQKITIEGDLTDQVIKEAAKKTEGFSGREIAKLVAGVQAAVYGR
QDCVLDSQLFEEIVDYKIEEHHQRIRLATEGGQSFP

MAASRLCSAAAIAAAFTSMSMSQNRAYADSSRFRFPFFSSSPSPPPSDSPANQSSSKSKA
EPDEPKGSGFDPEALERAAKALRDINSSPHSKQVFDLMRKQEKTRLAELTAETSHYEAIQ
AHNDIGRQQKLAEDQRNLLQTQAQTKAQNLRYEDELARKRQQTDHEAQRHHNVELVKMQE
ASSIRKEKAKIATEEQIQAQHRQTEKERAELERETIRVKAMAEAEGRAHEAKLTEEQNRR
LLMERINGEREKWLAAINTMFSHIEGGFRTLLTDRNKLIMTVGGATALAAGVYTTREGAR
VTWGYINRMLGQPSLIRESSMRRFPWTGSVSQFKNRISGAAAASAAEGKKPLDNVILHTS
LKKRIERLARATANTKSHQAPFRNMMFYGPPGTGKTMVAREIARKSGLDYAMMTGGDVAP
LGSQAVTKIHQIFDWAKKSNKGLLLFIDEADAFLCERNSTYMSEAQRSALNALLFRTGDQ
SRDIVLVLATNRRGDLDSAVTDRIDEVIEFPLPGEEERFKLLNLYLNKYLKMGDNNEDTK
PKWSHLFKKLSQKITVEEDLTDKVISEAAKKTEGFSGREIAKLVAGVQAGVYGRADCVLD
SQLFKEIVEYKVEEHHRRHMLASEGFQPLLFS

Other information
Ka divergence:0.232478KaKs divergence:0.0954667
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1911Length 2 (bp):1899Length divergence:-0.003
MFE 1 (kcal):-591.57MFE 2 (kcal):-589.68MFE divergence-0.002