Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18360-AT4G36610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alpha/beta-Hydrolases superfamily protein
Function (paralog2):alpha/beta-Hydrolases superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.1778527038038
Log2 mRNA fold difference:1.3010521583384
Log2 TE fold difference:-0.12868015406742
Sequences
Protein sequence

MVNFVDLQKPLLYRLMKLAGVIPYTVELEPGTKMNFWIPKETLKKTKKSDKNFAVEPQKP
TKPVLLFIHGFAAEGIVTWQFQVGSLAKKYSVYIPDLLFFGGSYSDNADRSPAFQAHCLV
KSLRILGIEKFTLVGFSYGGMVAFKIAEEYPEMVQAMVVSGSILAMTDTISESNLNQLGF
KSSADLLLPTSVKGLKTLFTLAVHKPMWFPKRLFKDFIEVMITNRKERAELLEALVISNK
DVTIPRFQQKIHLLWGESDQIFNLEFAKSMKEQLGENATMESIKKAGHLAHLERPCVYNR
RLKKFLASVYSEN

MVNFVEVQKPLLYGLMKMAGVVPYTLEIEPGTKINFWVPKETLKKNSGTGKPTKPDKPKK
PVVLLIHGFAGEGIVTWQFQVGALSKKYSVYIPDLLFFGGSYTDNSDRSPAFQADCLVKG
LRILGVDKFVPVGFSYGGMVAFKIAEAYPDMVRAIVVSGSIPTMTDTINEASLNRLGFSS
STDLLLPTSVTGLKALFTIAVHKPLWFPKRLFKDYIEVMFNNRKERAELLEAVVVSNKEA
QIPHFPRKIHFLWGESDQIFDLELARDMKEQIGENATIESIKKAGHLVQLERPCVYNRRL
KKFLASIHSEDKIKMLH

www.000webhost.com

Other information
Ka divergence:-0.123769KaKs divergence:-0.997001
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):942Length 2 (bp):954Length divergence:0.006
MFE 1 (kcal):-274.9MFE 2 (kcal):-280.83MFE divergence0.011