Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18520-AT4G36680
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tetratricopeptide repeat (TPR)-like superfamily protein
Function (paralog2):Tetratricopeptide repeat (TPR)-like superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.6075610000158
Log2 mRNA fold difference:0.17338922967344
Log2 TE fold difference:1.3389570413206
Sequences
Protein sequence

MTSSRLYLRFLRRFSTATGIDSQTTAYPGAITMSKAKSKLRKVQDPDKALAIYKSVSNNS
TSPLSSRYAMELTVQRLAKSQRFSDIEALIESHKNNPKIKTETFLSTLIRSYGRASMFDH
AMKMFEEMDKLGTPRTVVSFNALLAACLHSDLFERVPQLFDEFPQRYNNITPDKISYGML
IKSYCDSGKPEKAMEIMRDMEVKGVEVTIIAFTTILGSLYKNGLVDEAESLWIEMVNKGC
DLDNTVYNVRLMNAAKESPERVKELMEEMSSVGLKPDTVSYNYLMTAYCVKGMMSEAKKV
YEGLEQPNAATFRTLIFHLCINGLYDQGLTVFKKSAIVHKIPDFKTCKHLTEGLVKNNRM
EDARGVARIVKKKFPPRLVTEWKKLEEKLGLYSKGNAAAVSSSSQTREVLDQEREDDV

MASSRISLRLVRRFASAAADGTTTAPSSGKISVSKAKSTLRKEHDPDKALKIYANVSDHS
ASPVSSRYAQELTVRRLAKCRRFSDIETLIESHKNDPKIKEEPFYSTLIRSYGQASMFNH
AMRTFEQMDQYGTPRSAVSFNALLNACLHSKNFDKVPQLFDEIPQRYNKIIPDKISYGIL
IKSYCDSGTPEKAIEIMRQMQGKGMEVTTIAFTTILSSLYKKGELEVADNLWNEMVKKGC
ELDNAAYNVRIMSAQKESPERVKELIEEMSSMGLKPDTISYNYLMTAYCERGMLDEAKKV
YEGLEGNNCAPNAATFRTLIFHLCYSRLYEQGYAIFKKSVYMHKIPDFNTLKHLVVGLVE
NKKRDDAKGLIRTVKKKFPPSFLNAWKKLEEELGLYSKTDAFPSSAKEAAAA

www.000webhost.com

Other information
Ka divergence:-0.24149KaKs divergence:-0.485564
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):1257Length 2 (bp):1239Length divergence:-0.007
MFE 1 (kcal):-335.79MFE 2 (kcal):-339.35MFE divergence0.005