Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18540-AT4G36700
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RmlC-like cupins superfamily protein
Function (paralog2):RmlC-like cupins superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.092002171818
Log2 mRNA fold difference:3.1218313460657
Log2 TE fold difference:-1.1171566897508
Sequences
Protein sequence

MSRFRILPLSIFLCFVSLFFCTESFTHQNGVVPSFDPSYSSPLLVKKDQRTSVVATEFGN
ISAVQIGDGYHIQFITLEPNALLLPLLLHSDMVFFVHTGTGILNWIDEESERKLELRRGD
VFRLRSGTVFYVHSNEKLRVYAIFNVGKCLNDPCLGAYSSVRDLLLGFDDRTLRSAFAVP
EDILRKIRDATKPPLIVNALPRNRTQGLEEDKWQSRLVRLFVSVEDVTDHLAMKPIVDTN
KKKSRTFNVFEEDPDFENNNGRSIVVDEKDLDALKGSRFGVFMVNLTKGSMIGPHWNPSA
CEISIVLEGEGMVRVVNQQSLSSCKNDRKSESFMVEEGDVFVVPKFHPMAQMSFENSSFV
FMGFSTSAKTNHPQFLVGQSSVLKVLDRDVVAVSFNLSNETIKGLLKAQKESVIFECASC
AEGELSKLMREIEERKRREEEEIERRRKEEEEARKREEAKRREEEEAKRREEEETERKKR
EEEEARKREEERKREEEEAKRREEERKKREEEAEQARKREEEREKEEEMAKKREEERQRK
EREEVERKRREEQERKRREEEARKREEERKREEEMAKRREQERQRKEREEVERKIREEQE
RKREEEMAKRREQERQKKEREEMERKKREEEARKREEEMAKIREEERQRKEREDVERKRR
EEEAMRREEERKREEEAAKRAEEERRKKEEEEEKRRWPPQPKPPEEI

MTRFAVLPLSVLLLVLLFLCTESLAKSEESEEYDVAVPSCCGFSSPLLIKKDQWKPIFET
KFGQISTVQIGNGCGGMGPYKIHSITLEPNTILLPLLLHSDMVFFVDSGSGILNWVDEEA
KSTEIRLGDVYRLRPGSVFYLQSKPVDIFLGTKLKLYAIFSNNDECLHDPCFGAYSSITD
LMFGFDETILQSAFGVPEGIIELMRNRTKPPLIVSETLCTPGVANTWQLQPRLLKLFAGS
ADLVDNKKKKEKKEKKEKVKKAKTFNVFESEPDFESPYGRTITINRKDLKVLKGSMVGVS
MVNLTQGSMMGPHWNPWACEISIVLKGAGMVRVLRSSISSNTSSECKNVRFKVEEGDIFA
VPRLHPMAQMSFNNDSLVFVGFTTSAKNNEPQFLAGEDSALRMLDRQVLAASLNVSSVTI
DGLLGAQKEAVILECHSCAEGEIEKLKVEIERKKIDDERKRRHDERKKEEEEAKREEEER
RKREEEEEKKRWPPQQPPQEEELRERQLPMEKEWEMEGEEES

Other information
Ka divergence:0.135056KaKs divergence:0.114877
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):2124Length 2 (bp):1569Length divergence:-0.15
MFE 1 (kcal):-548.89MFE 2 (kcal):-511.89MFE divergence-0.035