Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18560-AT2G18570
Species:Arabidopsis
Duplication type:TD
Function (paralog1):UDP-Glycosyltransferase superfamily protein
Function (paralog2):UDP-Glycosyltransferase superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.28058766211557
Log2 mRNA fold difference:-0.99411455431169
Log2 TE fold difference:1.0004955941242
Sequences
Protein sequence

MREMKSTVRDAVKSMKQKPTVMIVDFFGTALLSITDVGVTSKYVYIPSHAWFLALIVYLP
VLDKVMEGEYVDIKEPMKIPGCKPVGPKELLDTMLDRSDQQYRDCVQIGLEIPMSDGVLV
NTWGELQGKTLAALREDIDLNRVIKVPVYPIGPIVRTNVLIEKPNSTFEWLDKQEERSVV
YVCLGSGGTLSFEQTMELAWGLELSCQSFLWVLRKPPSYLGASSKDDDQVSDGLPEGFLD
RTRGVGLVVTQWAPQVEILSHRSIGGFLSHCGWSSVLESLTKGVPIIAWPLYAEQWMNAT
LLTEEIGMAIRTSELPSKKVISREEVASLVKKIVAEEDKEGRKIKTKAEEVRVSSERAWT
HGGSSHSSLFEWAKRCGLVS

MDQPHALLVASPGLGHLIPILELGNRLSSVLNIHVTILAVTSGSSSPTETEAIHAAAART
ICQITEIPSVDVDNLVEPDATIFTKMVVKMRAMKPAVRDAVKLMKRKPTVMIVDFLGTEL
MSVADDVGMTAKYVYVPTHAWFLAVMVYLPVLDTVVEGEYVDIKEPLKIPGCKPVGPKEL
METMLDRSGQQYKECVRAGLEVPMSDGVLVNTWEELQGNTLAALREDEELSRVMKVPVYP
IGPIVRTNQHVDKPNSIFEWLDEQRERSVVFVCLGSGGTLTFEQTVELALGLELSGQRFV
WVLRRPASYLGAISSDDEQVSASLPEGFLDRTRGVGIVVTQWAPQVEILSHRSIGGFLSH
CGWSSALESLTKGVPIIAWPLYAEQWMNATLLTEEIGVAVRTSELPSERVIGREEVASLV
RKIMAEEDEEGQKIRAKAEEVRVSSERAWSKDGSSYNSLFEWAKRCYLVP

Other information
Ka divergence:-0.163396KaKs divergence:0.139535
GC content 1 (%):44GC content 2 (%):49GC content divergence:0.054
Length 1 (bp):1143Length 2 (bp):1413Length divergence:0.106
MFE 1 (kcal):-356.4MFE 2 (kcal):-481.56MFE divergence0.149