Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18570-AT4G36770
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):UDP-Glycosyltransferase superfamily protein
Function (paralog2):UDP-Glycosyltransferase superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.052633332382886
Log2 mRNA fold difference:-0.46307585709688
Log2 TE fold difference:0.43439017093872
Sequences
Protein sequence

MDQPHALLVASPGLGHLIPILELGNRLSSVLNIHVTILAVTSGSSSPTETEAIHAAAART
ICQITEIPSVDVDNLVEPDATIFTKMVVKMRAMKPAVRDAVKLMKRKPTVMIVDFLGTEL
MSVADDVGMTAKYVYVPTHAWFLAVMVYLPVLDTVVEGEYVDIKEPLKIPGCKPVGPKEL
METMLDRSGQQYKECVRAGLEVPMSDGVLVNTWEELQGNTLAALREDEELSRVMKVPVYP
IGPIVRTNQHVDKPNSIFEWLDEQRERSVVFVCLGSGGTLTFEQTVELALGLELSGQRFV
WVLRRPASYLGAISSDDEQVSASLPEGFLDRTRGVGIVVTQWAPQVEILSHRSIGGFLSH
CGWSSALESLTKGVPIIAWPLYAEQWMNATLLTEEIGVAVRTSELPSERVIGREEVASLV
RKIMAEEDEEGQKIRAKAEEVRVSSERAWSKDGSSYNSLFEWAKRCYLVP

MELHGALVASPGMGHAVPILELGKHLLNHHGFDRVTVFLVTDDVSRSKSLIGKTLMEEDP
KFVIRFIPLDVSGQDLSGSLLTKLAEMMRKALPEIKSSVMELEPRPRVFVVDLLGTEALE
VAKELGIMRKHVLVTTSAWFLAFTVYMASLDKQELYKQLSSIGALLIPGCSPVKFERAQD
PRKYIRELAESQRIGDEVITADGVFVNTWHSLEQVTIGSFLDPENLGRVMRGVPVYPVGP
LVRPAEPGLKHGVLDWLDLQPKESVVYVSFGSGGALTFEQTNELAYGLELTGHRFVWVVR
PPAEDDPSASMFDKTKNETEPLDFLPNGFLDRTKDIGLVVRTWAPQEEILAHKSTGGFVT
HCGWNSVLESIVNGVPMVAWPLYSEQKMNARMVSGELKIALQINVADGIVKKEVIAEMVK
RVMDEEEGKEMRKNVKELKKTAEEALNMTHIPSAYFT

www.000webhost.com

Other information
Ka divergence:0.266632KaKs divergence:-0.127507
GC content 1 (%):49GC content 2 (%):47GC content divergence:-0.021
Length 1 (bp):1413Length 2 (bp):1374Length divergence:-0.014
MFE 1 (kcal):-481.56MFE 2 (kcal):-451.92MFE divergence-0.032