Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18600-AT4G36800
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ubiquitin-conjugating enzyme family protein
Function (paralog2):RUB1 conjugating enzyme 1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:5.1020830140705
Log2 mRNA fold difference:4.3583045568722
Log2 TE fold difference:0.6629605992161
Sequences
Protein sequence

MIGLFKVKEKQREESQSNNGRGASTVKKQSAGELRLHKDISELNLPKSCKISFPNGKNDL
MNFEVTIKPDEGYYLSGNFVFSFQVSNMYPHEAPKVKCKTKVYHPNIDLEGNVCLNILRE
DWKPVLNINTVIYGLFHLFTEPNYEDPLNHEAAAVLRDNPKTFEYNVRRAMMGGQVGQTS
FPRCM

MIGLFKVKEKQREQAQNATRGGASVKKQSAGELRLHKDISELNLPSSCSISFPNGKDDLM
NFEVSIKPDDGYYHNGTFVFTFQVSPVYPHEAPKVKCKTKVYHPNIDLEGNVCLNILRED
WKPVLNINTVIYGLFHLFTEPNSEDPLNHDAAAVLRDNPKLFETNVRRAMTGGYVGQTFF
PRCI

Other information
Ka divergence:-0.226078KaKs divergence:0.283519
GC content 1 (%):42GC content 2 (%):40GC content divergence:-0.024
Length 1 (bp):558Length 2 (bp):555Length divergence:-0.003
MFE 1 (kcal):-160.52MFE 2 (kcal):-149.2MFE divergence-0.037