Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18620-AT4G36810
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Terpenoid synthases superfamily protein
Function (paralog2):geranylgeranyl pyrophosphate synthase 1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:3.141725218529
Log2 mRNA fold difference:2.2740148226316
Log2 TE fold difference:0.85401313717047
Sequences
Protein sequence

MTTLNLSIFPSVKISSSASIPGFIKIQPFLLRRKLSTVLSVTARDEGIIHNHFDFTSYMI
GKANAVNEALDSAVSLREPIKIHEAIRYSLLARGKRVRPVLCIAACELVGGEESVALPAA
CAVEMIHTMSLIHDDLPCMDNDDLRRGKPTNHKVFGEDVAVLAGDALISFAFEHLATSTA
VSPARVVRAIGELAKAIGSKGLVAGQVVDLTSGGMDQNDVGLEVLEFIHVHKTAVLLEAA
TVLGAIVGGGSDEEVEKLRRFARCIGLLFQVVDDILDVTKSSEELGKTAGKDLIADKLTY
PKLMGLEKSKDFADKLLSDAHEQLHGFDSSRVKPLLALANYIAKRQN

MASVTLGSWIVVHHHNHHHPSSILTKSRSRSCPITLTKPISFRSKRTVSSSSSIVSSSVV
TKEDNLRQSEPSSFDFMSYIITKAELVNKALDSAVPLREPLKIHEAMRYSLLAGGKRVRP
VLCIAACELVGGEESTAMPAACAVEMIHTMSLIHDDLPCMDNDDLRRGKPTNHKVFGEDV
AVLAGDALLSFAFEHLASATSSDVVSPVRVVRAVGELAKAIGTEGLVAGQVVDISSEGLD
LNDVGLEHLEFIHLHKTAALLEASAVLGAIVGGGSDDEIERLRKFARCIGLLFQVVDDIL
DVTKSSKELGKTAGKDLIADKLTYPKIMGLEKSREFAEKLNREARDQLLGFDSDKVAPLL
ALANYIAYRQN

Other information
Ka divergence:-0.213637KaKs divergence:-0.546576
GC content 1 (%):48GC content 2 (%):44GC content divergence:-0.043
Length 1 (bp):1044Length 2 (bp):1116Length divergence:0.033
MFE 1 (kcal):-344.85MFE 2 (kcal):-334.8MFE divergence-0.015