Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18650-AT4G30400
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.6033956057297
Log2 mRNA fold difference:1.5135273344463
Log2 TE fold difference:0.025478368055304
Sequences
Protein sequence

MNKILPEMKSTQNLISSSPPPPLIPLKSNTSLSNLNSKITPNILLIIIILSIIFFISGLL
HILVKFLLTPSRESREDYFDNVTALQGQLQQLFNLHDSGVDQSLIDTLPVFHYKSIVGLK
ISPFDCPVCLCEFETEDKLRLLPKCSHAFHVECIDTWLLSHSTCPLCRSNLLSGFSSHHN
LSSSYLLVLESEQSSRDMVPVLESNSQLGYDVNNDSESTRIRSGRKSCDPDGDMDGLDEK
VVPLEVKLGKFRNIDHVGEGSDQKKNSISGNSKNVDGRRCLSMGSYEYIMDQEATLKVHV
STKKLSGKDRVPSHRTVMSECGFDPTVKGIEKSVVERESFSLSKIWLRGKKEKQKGTSAR
DSDCSFVSSSSLRFPNHRIPPEESLKSENSESLETKTPSFARRTMHWLAGRQNKIVQPST
SNV

MKFSRENMKWVFPEIKTTQNFLSPSSLPQEPPLSLRSSANFDLNSKISPSILLIIIILSI
IFFISGLLHLLVRFLLTPSSRDREDYFDNVTALQGQLQQLFHLHDSGVDQSFIDTLPVFH
YKSIIGLKNYPFDCAVCLCEFETEDKLRLLPKCSHAFHMDCIDTWLLSHSTCPLCRSSLL
SDLSSHQDPRSSFLLVLESASDHSSREIGGDRDSAACVAANDDIDVSSAHLGLVGNNDLG
STRIDSGHGDQYLDGELGGSVGKVVPFSVKLGKFRNIDIGEGTSSNNNIGNSSSLDERRC
FSMGSYEYIMDEETTLKVHVSTKKQSSKNRGLPGHRTAMSECGFDPTGRLKFSGSGSMRI
VEEAAEKNVVERESFSVSKIWLRGKKEKHSKVQGKEDSSLVSSSSGRAFSFRLSNQRNHP
DAMIESGCEEDNQKCENSESLETKTPSFARRTMLWLAGRQNKVVHSSSSTNV

www.000webhost.com

Other information
Ka divergence:-0.232742KaKs divergence:-0.302083
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):1272Length 2 (bp):1419Length divergence:0.055
MFE 1 (kcal):-352.19MFE 2 (kcal):-420.82MFE divergence0.089