Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18660-AT4G30380
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):plant natriuretic peptide A
Function (paralog2):Barwin-related endoglucanase

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.1495828285289
Log2 mRNA fold difference:2.5715419849588
Log2 TE fold difference:-1.6286323291896
Sequences
Protein sequence

MIKMAVKFVVVMIVFAQILAPIAEAAQGKAVYYDPPYTRSACYGTQRETLVVGVKNNLWQ
NGRACGRRYRVRCIGATYNFDRACTGRTVDVKVVDFCREPCNGDLNLSRDAFRVIANTDA
GNIRVVYTPI

MSKSIVFFSTVLVFLFSFSYATPGIATFYTSYTPCYRGTQEGVMIAAASDTLWDNGRVCG
KMFTVKCSGPRNAVPHPCTGKSVKVKIVDHCPSGCASTLDLSREAFAQIANPVAGIINID
YFP

Other information
Ka divergence:-0.294159KaKs divergence:0.857534
GC content 1 (%):47GC content 2 (%):44GC content divergence:-0.033
Length 1 (bp):393Length 2 (bp):372Length divergence:-0.027
MFE 1 (kcal):-118.42MFE 2 (kcal):-105.7MFE divergence-0.057