Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18670-AT4G30370
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.76618156018
Log2 mRNA fold difference:0.45803577835225
Log2 TE fold difference:1.121878931566
Sequences
Protein sequence

MPPTNNYRISGEPPSTTPSHPPPKPKTRILSLFLVGVIMFSIFFLFLVLIGIASVLILPL
LLSSLHRHHRRRRRNRRQESSDGLSSRFVKKLPQFKFSEPSTYTRYESDCVVCFDGFRQG
QWCRNLPGCGHVFHRKCVDTWLLKASTCPICRARVRLWEEDPQEGELWRCFGHRRSSLLD
L

MSITIPYDGSISREPSPSPPPPKANTKNLPTKILSNFLIGLIMIPVAITAFIFILTSLGF
TFFFAFYWFLQRNYRHRLRRHRRHEYSDGLSPRCVKRLPQFKYCEPSSEYGGDDCVVCID
GFRQGQWCRKLPRCGHVFHRKCVDLWLIKVSTCPICRDRVYRFEEGRRWRPQGEIF

www.000webhost.com

Other information
Ka divergence:0.393097KaKs divergence:0.755314
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):546Length 2 (bp):531Length divergence:-0.014
MFE 1 (kcal):-145.92MFE 2 (kcal):-161.2MFE divergence0.05