Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18680-AT2G18690
Species:Arabidopsis
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:6.3555163038739
Log2 mRNA fold difference:5.5534459344668
Log2 TE fold difference:0.75252316636617
Sequences
Protein sequence

MFSVLVFPLLLNCLVYLFNAIAIKPEITNLILESSLLPMTDPNTPEFAAHLMRVFVDFRQ
FVNSLYIFIAVSSIINLLSTLVMVHASALTHKDDSFEIKDFPILTLKYWKGPLVTNFYIV
LFSLGYWFLFFIVLFSIVFFSTKLDSLAAKSRALFIVFAVFESYLAIVWNLSMVISILED
TYGIQALGKAAKIVKGMKPKLFLLNLFFGLLSFGLVQILRLVDWSSSFSVTLTTGLVLMS
SVFVVRMFQLVTYTVAYFQCKSLQGQDSLRDVEYTKLSSTTLMGGLP

MARFSFLNVVKDVVAILNESRKLFLKNKKLMFSVLVFPLLLNCLVYFLNIFVIVPEITNL
ILEASLLPSTDPTSPEYAARLMRVFTDFRQFVGSSYIFAAVSSIINLFSVLVIVHASAIT
LKDENFNIKDFPVLSLKSWKGPLVTYFYIALFSLGFGFLFFIILCPILLFSIKSGSVENI
GFLAVEAGVLLIIFTVSQSYFAIYWNLSMVISILEESYGFQALGKAAKIVKGMKTKLFLL
NLFFGLLASGLAQILQLINMGRSLAVTLTTGFVLVCLVFAVRMFQLVTYTVAYFQCKSLQ
GRDVESLRDVEYMALSSTTLTE

www.000webhost.com

Other information
Ka divergence:-0.00617894KaKs divergence:-0.999228
GC content 1 (%):40GC content 2 (%):41GC content divergence:0.012
Length 1 (bp):864Length 2 (bp):969Length divergence:0.057
MFE 1 (kcal):-217.66MFE 2 (kcal):-254.3MFE divergence0.078