Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18730-AT4G30340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):diacylglycerol kinase 3
Function (paralog2):diacylglycerol kinase 7

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.86382768835217
Log2 mRNA fold difference:-1.2241756211405
Log2 TE fold difference:0.23492422307284
Sequences
Protein sequence

MDSPVSKTDASKEKFVASRPSTADSKTMRGCGLANLAWVGVDKVELRQRLMMPEYLRLAM
RDCIKRKDSSAIPDHLLLPGGAVADMAPHAPMVVFINPNSGGRHGPVLKERLQQLMSEEQ
VFDLTEVKPHEFVRYGLGCLEKVAAEGDECAKECRARLRIMVAGGDGTVGWVLGCLGELN
KDGKSQIPPVGVIPLGTGNDLSRSFGWGGSFPFAWRSAVKRTLHRASMGPVARLDSWKIL
VSMPSGEVVDPPYSLKPAEENELDQGLDAGIDAPPLAKAYEGVFYNYLSIGMDAQVAYGF
HHLRNTKPYLAQGPISNKIIYSSFGCSQGWFCTPCVNDPGLRGLRNIMKIHIKKVNCSQW
EEIAVPKNVRSIVALNLHSYGSGSHPWGNLKPDYLEKRGFVEAHCDDGLIEIFGFKQGWH
ASFVMAELISAKHIAQAAAVRFELRGGDWRDAFLQMDGEPWKQPMSTEYSTFVEIKKVPY
QSLMINNE

MEETPRSVGEASTTNFVAARPSAKTDDAVTMRGCGFANLALVGIDKEELRGRLAMPEYLR
IAMRDCIKRKDSTEISDHLLLPGGAAADMAPHAPMVVFINPKSGGRHGPVLKERLQQLMT
EEQVFDLTEVKPHEFVRYGLGCLDTLAAKGDECARECREKIRIMVAGGDGTVGWVLGCLG
ELHKDGKSHIPPVGVIPLGTGNDLSRSFSWGGSFPFAWRSAMKRTLHRATLGSIARLDSW
KIVVSMPSGEVVDPPYSLKPTIEETALDQALDADGDVPPKAKSYEGVFYNYFSIGMDAQV
AYGFHHLRNEKPYLAQGPVTNKIIYSSYSCTQGWFCTPCVNNPALRGLRNIMKIHIKKAN
CSEWEEIHVPKSVRSIVVLNLYNYGSGRHPWGNLRPKYLEKRGFVEAHCDDGLIEIFGLK
QGWHASFVMAEIISAKHIAQAAAIRFELRGGDWKNAFLQMDGEPWKQPMKSDYSTFVEIK
KVPFQSLMINGE

Other information
Ka divergence:-0.0441162KaKs divergence:-0.00809139
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):1467Length 2 (bp):1479Length divergence:0.004
MFE 1 (kcal):-493.51MFE 2 (kcal):-453.6MFE divergence-0.042