Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18740-AT4G30330
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Small nuclear ribonucleoprotein family protein
Function (paralog2):Small nuclear ribonucleoprotein family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.80950541305732
Log2 mRNA fold difference:-1.1228086803297
Log2 TE fold difference:0.60579174434238
Sequences
Protein sequence

MASTKVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRITGFDEYMNLVLDEAEEV
SIKKNTRKPLGRILLKGDNITLMMNTGK

MASTKVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRITGFDEYMNLVLDEAEEV
SIKKKTRKPLGRILLKGDNITLMMNAGK

Other information
Ka divergence:-0.00926334KaKs divergence:0.359684
GC content 1 (%):39GC content 2 (%):41GC content divergence:0.025
Length 1 (bp):267Length 2 (bp):267Length divergence:0
MFE 1 (kcal):-57.8MFE 2 (kcal):-70.6MFE divergence0.1