Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18840-AT4G30260
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Integral membrane Yip1 family protein
Function (paralog2):Integral membrane Yip1 family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.2151484279651
Log2 mRNA fold difference:1.1105124322086
Log2 TE fold difference:0.20294232716657
Sequences
Protein sequence

MSQGDTVPLHPSSQSDIDEIENLINESVQSGPGTVLAARPPSPTRPSIPVSSSSSSSPFM
QSNLPPLHPSSSAQKVTHVPVPPPLPAVSNSSNFQGASAFGSPPNTLTEPVWDTVKRDLS
RIVSNLKLVVFPNPYREDPGKALRDWDLWGPFFFIVFLGLTLSWSASVKKSEVFAVAFAL
LAAGAVILTLNVLLLGGHIIFFQSLSLLGYCLFPLDVGAVICMLKDNVILKMVVVSVTLA
WSSWAAYPFMSSAVNPRRKALALYPVFLMYVSVGFLIIAIN

MSHNDTIPLYQSSQSDIDEIENMMNDSFQSGPGTVLPARPPSPIRPSIPVSSSPFVQSNL
PPLPPSSSSSTQKVMPVPAPPPLPSAGNEGNKSIGGSGFGSPPNTLTEPVWDTVKRDLSR
IVSNLKLVVFPNPYREDPGKALRDWDLWGPFFFIVFLGLTLSWSASVKKSEVFAVAFALL
AAGAVILTLNVLLLGGHIIFFQSLSLLGYCLFPLDVGAVICMLKDNVILKMVVVSVTLAW
SSWAAYPFMSAAVNPRRKALALYPVFLMYVSVGFLIIAIN

Other information
Ka divergence:-0.146444KaKs divergence:0.0389206
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):846Length 2 (bp):843Length divergence:-0.002
MFE 1 (kcal):-253.11MFE 2 (kcal):-252.4MFE divergence-0.001