Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18860-AT4G30240
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Syntaxin/t-SNARE family protein
Function (paralog2):Syntaxin/t-SNARE family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.09768178597813
Log2 mRNA fold difference:0.70353527798521
Log2 TE fold difference:-0.58567787249744
Sequences
Protein sequence

MMVVNSFDLWQKDVFFSAAEEVQKSTDIMESAYRLWIREKKDEICKELQAALGTAKWQLE
EFEKAVRLSHKRCGDNDSSSTRHKQFVTAIENQIHRVETSLQEAYSENGKKPLRWVDLNE
EERDDLAMFLSGSSRTSQSFSGESSIKSRESTNSSLVENVMEVSAKVTFKKAKVYGDGSE
CVIDIEERVTPGQAEKSVGLRRIWSSPNFNSLRIIVPGGDNEEEKETLVAQIEATPKVKG
TKSVLWMQRLPDHNQLFDKTGCFQNPIRLPFNHPIKFIVSLLLMVFLLLPFVVYLS

MMVANSFDLWQKDVFFSAAEEVQESADIMESAYRLWFKEKRDGRVSVESDELCKELQAAL
STAKWQLEEFERAVSLSHGNCRDDTTLTRHKQFVTAIENQIYQVESTLLESLSENGKQPL
RWVDLNKEERDDLAMFLSGSSQTSESLNSDSINLRDSSTSSVAENPRGINGRREGRCYGD
SPDCVIDIDDIGSPESADKKGGTRRTWSSPNVPNISALRINVPVNAKEEEREKFLSHIED
TPKEKGAKPMFWLQRCRDYNQLFDRVKVYQRRFRVPLSRPIKLILSLTLILILLLFILRT

www.000webhost.com

Other information
Ka divergence:-0.0204845KaKs divergence:0.240559
GC content 1 (%):39GC content 2 (%):41GC content divergence:0.025
Length 1 (bp):891Length 2 (bp):903Length divergence:0.007
MFE 1 (kcal):-233.24MFE 2 (kcal):-260.07MFE divergence0.054