Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18960-AT4G30190
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):H(+)-ATPase 1
Function (paralog2):H(+)-ATPase 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.24103705835211
Log2 mRNA fold difference:0.4068871964085
Log2 TE fold difference:-0.16412435344294
Sequences
Protein sequence

MSGLEDIKNETVDLEKIPIEEVFQQLKCTREGLTTQEGEDRIVIFGPNKLEEKKESKILK
FLGFMWNPLSWVMEAAALMAIALANGDNRPPDWQDFVGIICLLVINSTISFIEENNAGNA
AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSA
LTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL
TSIGNFCICSIAIGIAIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLL
FAAMASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHR
VSKGAPEQILDLANARPDLRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFV
GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSAALLGT
DKDSNIASIPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKAD
IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF
MLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTPDSWKLKEIFATGIVLGGYQ
AIMSVIFFWAAHKTDFFSDKFGVRSIRDNNDELMGAVYLQVSIISQALIFVTRSRSWSFV
ERPGALLMIAFVIAQLVATLIAVYADWTFAKVKGIGWGWAGVIWIYSIVTYFPQDILKFA
IRYILSGKAWASLFDNRTAFTTKKDYGIGEREAQWAQAQRTLHGLQPKEDVNIFPEKGSY
RELSEIAEQAKRRAEIARLRELHTLKGHVESVAKLKGLDIDTAGHHYTV

MSSLEDIKNETVDLEKIPIEEVFQQLKCSREGLTTQEGEDRIQIFGPNKLEEKKESKLLK
FLGFMWNPLSWVMEMAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNA
AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSA
LTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL
TAIGNFCICSIAIGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLL
FAAMASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGSGNWHR
VSKGAPEQILELAKASNDLSKKVLSIIDKYAERGLRSLAVARQVVPEKTKESPGAPWEFV
GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGT
HKDANLASIPVEELIEKADGFAGVFPGYNLLIYCLDYKPHYMFIAKVVMLVLSFVFFIAE
HKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDIVLTEPGLSV
IISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTI
MTISKDRVKPSPTPDSWKLKEIFATGVVLGGYQAIMTVIFFWAAHKTDFFSDTFGVRSIR
DNNHELMGAVYLQVSIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLIATLIAVYANW
EFAKIRGIGWGWAGVIWLYSIVTYFPLDVFKFAIRYILSGKAWLNLFENKTAFTMKKDYG
KEEREAQWALAQRTLHGLQPKEAVNIFPEKGSYRELSEIAEQAKRRAEIARLRELHTLKG
HVESVVKLKGLDIETPSHYTV

www.000webhost.com

Other information
Ka divergence:-0.112913KaKs divergence:0.999448
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):2850Length 2 (bp):2946Length divergence:0.017
MFE 1 (kcal):-937.95MFE 2 (kcal):-951.66MFE divergence0.007