Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G18980-AT4G30170
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Peroxidase superfamily protein
Function (paralog2):Peroxidase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.8654171753841
Log2 mRNA fold difference:2.1957592703527
Log2 TE fold difference:-0.31707905195459
Sequences
Protein sequence

MKNQSSFSIVALLLIFFSSSVFAQLQTNFYRKSCPNVETIVRNAVRQKFQQTFVTAPATL
RLFFHDCFVRGCDASILLASPSEKDHPDDKSLAGDGFDTVAKAKQALDRDPNCRNKVSCA
DILALATRDVVVLTGGPNYPVELGRRDGRLSTVASVQHSLPQPSFKLDQLNTMFARHGLS
QTDMIALSGAHTIGFAHCGKFSKRIYNFSPKRPIDPTLNIRYALQLRQMCPIRVDLRIAI
NMDPTSPNTFDNAYFKNLQKGMGLFTSDQVLFSDERSRSTVNSFASSEATFRQAFISAIT
KLGRVGVKTGNAGEIRRDCSRVN

MEKNTSQTIFSNFFLLLLLSSCVSAQLRTGFYQNSCPNVETIVRNAVRQKFQQTFVTAPA
TLRLFFHDCFVRGCDASIMIASPSERDHPDDMSLAGDGFDTVVKAKQAVDSNPNCRNKVS
CADILALATREVVVLTGGPSYPVELGRRDGRISTKASVQSQLPQPEFNLNQLNGMFSRHG
LSQTDMIALSGAHTIGFAHCGKMSKRIYNFSPTTRIDPSINRGYVVQLKQMCPIGVDVRI
AINMDPTSPRTFDNAYFKNLQQGKGLFTSDQILFTDQRSRSTVNSFANSEGAFRQAFITA
ITKLGRVGVLTGNAGEIRRDCSRVN

Other information
Ka divergence:0.0180898KaKs divergence:-0.173983
GC content 1 (%):45GC content 2 (%):47GC content divergence:0.022
Length 1 (bp):972Length 2 (bp):978Length divergence:0.003
MFE 1 (kcal):-292.2MFE 2 (kcal):-302.12MFE divergence0.017