Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G19090-AT4G30130
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF630 and DUF632)
Function (paralog2):Protein of unknown function (DUF630 and DUF632)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.9546007492726
Log2 mRNA fold difference:-2.9490257578906
Log2 TE fold difference:0.26262275256718
Sequences
Protein sequence

MGCSHSKLDDEEAVQICKDRKRFIKQAIEHRTKFASGHIAYIHSLRKVSDALHDFILQGD
NNNEFVPTLCQDSFVTPVKRMPQRRRRSSRSNSGEFISISPSSIPPKMIQGRPRSNVKAN
YLMANRSRPVRVEQRSPETFRVETFSPPSSSNQYGESDGFFGMNMNMNTSASTSSSFWNP
LSSPEQRLSSHNIPPPSPQNSQWDFFWNPFSSLDYYGYNSYDRGSVDSRSGIDDEIRGLR
RVREEEGIPDLEEDDEPHKPEPVVNVRFQNHNPNPKATEENRGKVDKSCCNEEVKVEDVD
EDEDEDGDEDDDEFTDSGCETENEGDEKCVAPPTQEQRKAEVCRGGEATGNVVGVGKVQE
MKNVVGVRDDAKTTGFTVYVNRRPTSMAEVIKDLEDQFTTICDAAKEVSGLLEAGRAQYT
SSFNDHSARKMLNPVALFRSGSSRSSSSRFLITSSGGSRESGSESRSDVSDESCMISGSH
QTTLDRLFAWEKKLYDEVRSGERVRRAYEKKCMQLRNQDVKGDDPLAVDKTRATIRDLDT
QIKVSIHSIESISKRIETLRDQELLPQLLELVEGLTRMWKVMAESHQIQKRTLDEAKLLL
AGTPVSKRHKKRQPPIMPEAINSQRLAQSALNLEAQLRNWRTCFEFWITSQRSYMKALSG
WLLRCFRCDPDPEKVRLSSCLHPIYRVCIQWSRLLNSLNEKPVLDKLEFFASGMGSIYAR
QVREDPNWSGSGSRRYSGSESMELVVADKGEEDVVMTAEKLAEVAVKVLCHGMSVAVSSL
AEFSINSADEHSKLVSQPADDASEQQPPDVNFNS

MGCSHSKFDDDEAVQICKDRKRFIKQAVEHRTGFASGHIAYIQSLRKVSDALREYIEGDE
PHEFMLDTCVTPVKRMSSSGGFIEISPPSKMVQSEAESKLNVNSYLMASGSRPVRVEEKP
PRSPETFQVETYGADSFFGMNMNMNSPGLGSHNIPPPSPQNSQWDFFWNPFSALDQYGYS
YDNQNGMDDDMRRLRRVREEEGIPDLEEDEYVKFEDHHNMKATEDFNGGKMYQEDKVEHV
NEEFTDSGCKIENESDKNCNGTQERRSLEVSRGGTTGHVVGVTSDDGKGETPGFTVYLNR
RPTSMAEVIKDLEDQFAIICTAGKEVSGLLEASRVQYTSSNELSAMTMLNPVALFRSGGS
SRSSSSSRFLISSSGGSRASEFESSSEFSEESCMLSGSHQSTLDRLYAWEKKLYDEVKSG
DRIRIAYEKKCLVLRNQDVKGADSSAVDKTRATIRDLHTQIKVSIHSIESISERIETLRD
QELLPQLLELVQGLAQMWKVMAECHQIQKRTLDEAKLLLATTPSNRHKKQQQTSLPEINS
QRLARSALHLVVQLRNWRACFQAWITSQRSYILSLTGWLLRCFRCDPDPEKVTLTSCPHP
IYEVCIQWSRLLNGLNEKPVLDKLDFFASGMGAIYARQLKEDTSPVTDSSRKYSRPESME
LVEAEKVEEEKIMTAEKLAEIAVKVLCHGMSVAVSSLAEFSISSADEHSKLVTHREEDMP
EQTKI

Other information
Ka divergence:-0.067066KaKs divergence:-0.141268
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):2445Length 2 (bp):2178Length divergence:-0.058
MFE 1 (kcal):-727.12MFE 2 (kcal):-684.34MFE divergence-0.03