Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G19120-AT4G30100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):P-loop containing nucleoside triphosphate hydrolases superfamily protein
Function (paralog2):P-loop containing nucleoside triphosphate hydrolases superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:3.1460308666346
Log2 mRNA fold difference:3.0379581617154
Log2 TE fold difference:0.089343772971776
Sequences
Protein sequence

MDSDASAKENTQDLSDYKGMIETGGEGSVRDELQEPGLMVKQREVKGVEASYAVKCANTT
VKRKMDQHKEAMLGKKRNRQTRFLNLEDVKQAGTVNTSTPRRQNFAQAVPTRSSAVNPPA
EHGGESQSQSHQNLKSVDFPSTGGIHSESAEQKTESNGESYSGLLGKPRRLNRDEEPSAE
GMGTSVSRQASWKQPANIRQPKSGHSSSRKVSYSQRSFKKPATSSTQYQDTSVERLIREV
TNEKFWRHPEDTELRSVPERFESMEEYVRVFEPLLFEECRAQLYSTWVELAEANTYVKVR
IKSIERRERGWYDVILNSLNGCKWAFKEGDVAVLSTPLPESDEDHEDAGRVAGTVRRHIP
VDTRDPRGATLHFYVGNSGGTGSKIDDSHILRKLKPQDIWHLTVLGSLATTQREYVALHA
FSRLNPQMQNAILNPSPEQFPSYEEQTPATPDCFTTSFVDHLHRSFNAPQLAAIHWAAMH
TAAGTSSGVKKQEPWPFTLVQGPPGTGKTHTVWGMLNVIHLVQYQQYYTSLLKKLAPETY
NQANECSSSDNILSGSIDEVLQNMDHNLFRTLPKLCAKPRMLVCAPSNAATDELLSRVLD
RGFIDGEMRVYRPDVARVGVDSQSRAAQAVSVERRSDQLLAISRDEILRHMRNLRLQETQ
ISQNIAGLKRELNAAAFATRSQGSVGVDPEVLISRDQKRDALLQHLAAVVEARDKVLVEI
SRLLIVEGKFRAGNNFNLEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTHGFDMVVI
DEAAQASEVGVLPPLALGAARCVLVGDPQQLPATVISKAAGTLLYSRSLFERFQLAGCPT
LLLTVQYRMHPQIRDFPSRYFYQGRLKDSESISSAPDEIYYKDPVLRPYLFFNISHGRES
HRGGSVSYENVDEARFCVGVYMHLQKTLKSLGAGKVSVGVITPYKLQLKCLKHEFGNALG
QDELKEIYINTVDAFQGQERDVIIMSCVRASGHGVGFVSDIRRMNVALTRARRALWVMGN
ASALMKSEDWAALISDARGRNCFMEMDSLPLDFPIPKVSSYNPMAPNNGLITSKLYPSDA
PIIGLHTKLR

MASEGKLLFDLNELPTEDDDGIDNVNFNQQPQVTIPSSNPSSSALLATPSSSQDNVNNNR
VFSHASTVSGFQPFVRPVAAQHTDVAVERKVDEGSLEEAKVTSLKVPNDVGAPEREEGEW
TESEVPANDNVHSSSDYSTVTEKDNGTLGLDINSDSALQKKNVNHISESSGKDSGSIDSP
QEQGLTVRPRETKGVEASHAIKCANTTVKRKMDHQKETMLGKKRHRQTMFLNLDDVRQAG
PIKTTTPRRQNFPQPVVTRTVRESRAGPPTAEQAGGVPGHVVYRDQKPIDIPNGGIHPET
SEPKLESNGESQSGSAGKTRRMNGEAGPSAEATSTSVSRQGSWKQPINSRQLKSGHSSNR
QVPLCSQTSADSKFGNKKFTSFKKQATNSTQYQDTSVERLLREVTNEKFWHHPEDTDLQS
VPERFESMDEYVRVFEPLLFEECRAQLYSTWEELAEANSYMKVRIKFIERRERGWYDVIL
NSVNECKWAFKEGDVAVLSNPVPESEGEHDDVGRVAGTVRRYIPVDTRDPHGAILHFYVG
DAYDSGSKIDDNHILRKLKPKEIWHLTVLGSIATTQREYVALHAFSQLNPQMQNAILKPS
PEQFPNYGEQTPTVPDCFTPSFAGHLHRSFNAPQLAAIHWAAMHTAAGTSSGVKRQDPWP
FTLVQGPPGTGKTHTVWGMLNVIHLVQYQQYYTSLLKKLAPESYKQVNESSSDNIVSGSI
DEVLQNMDQNLFRTLPKLCAKPRMLVCAPSNAATDELLSRVLDRGFIDGEMRVYRPDVAR
VGVDTQTKAAQAVSVERRSDLLLAKSREEILGHIHNLRVRDAQLSQDIAGLKRELTAAAF
ANRSQGSVGVDPDVLMVRDQTRDAMLQRLSAVVEARDKDLVEMSRLLIVEGKFRAGTSFN
LEEARASLEASFANEAEIVFTTVSSSGRKLFSRLTHGFDMVVIDEAAQASEVGVLPPLAL
GAARCVLVGDPQQLPATVISKAAGTLLYSRSLFERFQLAGCPTLLLTVQYRMHPQIRDFP
SRYFYQGRLTDSESVSTAPDEIYYKDSVLKPYLFFDISHGRESHRGGSVSYENIDEARFC
VGVYLHLQRTLKSLGGGKVSVGVITPYKLQLKCLKIEFGNALSQDELQEIYINTVDAFQG
QERDVIIMSCVRASNHGVGFVADIRRMNVALTRAKRALWVMGNASALMKCEDWAALITDA
KARNCFMEMESLPKDFPVPKVPSFIPKAPNARGFRSGGPRTRSIDMHPESRSGTPSEDDK
KLSTTTFPRNGNSRRENSVDDSDPPGDRYRDAWQHGIQRRQNFGRPLGRRD

Other information
Ka divergence:-0.123515KaKs divergence:-0.0946089
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):3273Length 2 (bp):3936Length divergence:0.092
MFE 1 (kcal):-1026MFE 2 (kcal):-1224.99MFE divergence0.088