Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G19160-AT4G30060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein
Function (paralog2):Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.34181505631514
Log2 mRNA fold difference:0.75999349016408
Log2 TE fold difference:-0.35009281170581
Sequences
Protein sequence

MKAIKGWRLGKINYMQSLPGARHRAPTRKPIWIIAVLSLIAMFVIGAYMFPHHSKAACYM
FSSKGCKGLTDWLPPSLREYSDDEIAARVVISEILSSPRVIKKSSKIAFMFLTPGTLPFE
KLWDLFFQGHEGKFSVYIHASKDTPVHTSRYFLNREIRSDEVVWGRISMIDAERRLLTNA
LRDPENQQFVLLSDSCVPLRSFEYMYNYMMHSNVSYVDCFDDPGPHGTGRHMDHMLPEIP
REDFRKGAQWFSMKRQHAVVTVADNLYYSKFRDYCGPGVEGNKNCIADEHYLPTFFYMLD
PTGIANWTVTYVDWSERKWHPRKYMPEDITLELIKNISSIDAVSRVTSEKNGVVSWTHCM
WNGIKRPCYLFGRKFHADTLDKLMELFPNYTSIV

MKAVKRWSIGNLADIPVSLPGARYRAPPPGRRRVWIIMVLSLITMFFIMAYMYPHHSKRA
CYMISSRGCKALADWLPPSLREYSDDEIAARVVIREILSSPPVIRKNSKIAFMFLTPGTL
PFERLWDRFFLGHEGKFSVYIHASKERPVHYSRYFLNREIRSDEVVWGRISMVDAERRLL
ANALRDTSNQQFVLLSDSCVPLRSFEYIYNYLMHSNLSYVDCFDDPGQHGAGRHMNHMLP
EIPKKDFRKGAQWFTMKRQHAVATMADSLYYSKFRDYCGPGIENNKNCIADEHYLPTFFH
MLDPGGIANWTVTQVDWSERKWHPKTYMPEDITHELLNNLTSTDTLVHVTSVGMGEEIWM
PCMWNGIQRPCYLFGRKFHPDTLDKLLDLFSNYTRSVTWNL

Other information
Ka divergence:-0.313079KaKs divergence:-0.243809
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1185Length 2 (bp):1206Length divergence:0.009
MFE 1 (kcal):-351.57MFE 2 (kcal):-345.47MFE divergence-0.009