Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G19170-AT4G30020
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):subtilisin-like serine protease 3
Function (paralog2):PA-domain containing subtilase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.6460842712715
Log2 mRNA fold difference:2.38671612787
Log2 TE fold difference:0.18476184401663
Sequences
Protein sequence

MDIGLRIFVVFVLLVAVTAEVYIVTMEGDPIISYKGGENGFEATAVESDEKIDTSSELVT
VYARHLERKHDMILGMLFEEGSYKKLYSYKHLINGFAAHVSPEQAETLRRAPGVRSVDKD
WKVRRLTTHTPEFLGLPTDVWPTGGGFDRAGEDIVIGFVDSGIYPHHPSFASHHRLPYGP
LPHYKGKCEEDPHTKKSFCNRKIVGAQHFAEAAKAAGAFNPDIDYASPMDGDGHGSHTAA
IAAGNNGIPLRMHGYEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVDI
LSLSVGPNSPPTTTKTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITTV
AAAIDDRRYKNHLTLGNGKMLAGMGLSPPTRPHRLYTLVSANDVLLDSSVSKYNPSDCQR
PEVFNKKLVEGNILLCGYSFNFVVGTASIKKVVATAKHLGAAGFVLVVENVSPGTKFDPV
PSAIPGILITDVSKSMDLIDYYNASTSRDWTGRVKSFKAEGSIGDGLAPVLHKSAPQVAL
FSARGPNTKDFSFQDADLLKPDILAPGYLIWAAWCPNGTDEPNYVGEGFALISGTSMAAP
HIAGIAALVKQKHPQWSPAAIKSALMTTSTVIDRAGRLLQAQQYSDTEAVTLVKATPFDY
GSGHVNPSAALDPGLIFDAGYEDYLGFLCTTPGISAHEIRNYTNTACNYDMKHPSNFNAP
SIAVSHLVGTQTVTRKVTNVAEVEETYTITARMQPSIAIEVNPPAMTLRPGATRTFSVTM
TVRSVSGVYSFGEVKLKGSRGHKVRIPVVALGHRR

MDIGCKVLVFFTCFLTVTAEIYIVTMEGEPIISYKGGDNGFEATAVESDEKIDTTSELVT
SYARHLERKHDMLLGMLFVEGSYKKLYSYKHLINGFAAHVSPDQAEMLRRAPGVKSVDRD
WKVRKLTTHTPQFLGLPTDVWPTGGGYDRAGEDIVIGFIDSGIFPHHPSFASHHTTVPYG
PHPSYKGKCEEDPHTKISFCNGKIIGAQHFAEAAKAAGAFNPDIDFASPMDGDGHGSHTA
AIAAGNNGIPVRMHGYEFGKASGMAPRARIAVYKALYRLFGGFVADVVAAIDQAVHDGVD
ILSLSVGPNSPPATTKTTFLNPFDATLLGAVKAGVFVAQAAGNGGPFPKTLVSYSPWITT
VAAAIDDRRYKNHLTLGNGKMLAGIGLSPSTRPHRSYKMVSANDVLLGSSGMKYNPSDCQ
KPEVLNKKLVEGNILLCGYSFNFVAGSASIKKVAETAKHLGAAGFVLVVENVSPGTKFDP
VPSCIPGILITDVSKSMDLIDYYNVTTSRDWMGRVKDFKAEGSIGDGLEPILHKSAPEVA
LFSARGPNTKDFSFQDADLLKPDILAPGSLIWSAWSANGTDEANYIGEGFALISGTSMAA
PHIAGIAALVKQKHPQWSPAAIKSALMTTSTVIDRAGRPLQAQQYSETETVTLVKATPFD
YGSGHVNPSAALDPGLIFDAGYEDYIGFLCTTPGIDAHEIKNFTNTPCNFKMVHPSNFNT
PSIAISHLVRTQTVTRRVTNVAEEEETYTITSRMEPAIAIEVSPPAMTVRAGASRTFSVT
LTVRSVTGAYSFGQVTLKGSRGHKVTLPVVAMGQRR

Other information
Ka divergence:0.0604938KaKs divergence:-0.0331825
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):2448Length 2 (bp):2451Length divergence:0.001
MFE 1 (kcal):-782.42MFE 2 (kcal):-755.36MFE divergence-0.018