Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G19340-AT4G29870
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Oligosaccharyltransferase complex/magnesium transporter family protein
Function (paralog2):Oligosaccharyltransferase complex/magnesium transporter family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.4568028832369
Log2 mRNA fold difference:3.2123803068662
Log2 TE fold difference:-0.75186277051418
Sequences
Protein sequence

MAPRSDSQTGSSVSDGSDQSSMDPIFHLLRIVPFSFLRPPRLRLKIPSFTLPSPMTVYAL
ILLTYFLVVSGFVYDVIVEPPGIGSTQDPTTGTIRPVVFMSGRVNGQYIIEGLSSGFMFV
LGGIGIVMLDLALDKNKAKSVKASYAVAGVSSIVIAYVMSSWRKETTWREHSRIPRRSKT
VDGAVLRHDEPFSLLSIPAS

MAPRSDSQTLATGSDENESSIDPIFHILRIIPFSFLRPPRLRLKLPSFTLPSPMTVFSLI
LLTYFLVVSGFVYDVIVEPPGIGSTQDPITGSVRPVVFMSGRVNGQYIIEGLSSGFMFVL
GGIGIIMLDLALDKNRAKSVKASYATAGVSSIVIAYVMSMLFIRIKIPGYLR

Other information
Ka divergence:-0.804364KaKs divergence:-0.881962
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):603Length 2 (bp):519Length divergence:-0.075
MFE 1 (kcal):-164.13MFE 2 (kcal):-139.26MFE divergence-0.082