Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G19350-AT4G29850
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Eukaryotic protein of unknown function (DUF872)
Function (paralog2):Eukaryotic protein of unknown function (DUF872)

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-1.6512953290331
Log2 mRNA fold difference:-0.74596582011601
Log2 TE fold difference:-0.83724651316752
Sequences
Protein sequence

MAYVDHAFSISDEDLMIGTSYTVSNRPPVKEISLAVGLLVFGTLGIVLGFFMAYNRVGGD
RGHGIFFIVLGCLLFIPGFYYTRIAYYAYKGYKGFSFSNIPSV

MAYVDHAFSITDEDIMIETSYTVNNRPPVKEIALAVALLVFGTLGIVSGFFMAYNRVGGD
RGHGIFFIVLGCLLFIPGFYYTRIAYYAYKGYKGFSFSNIPPV

www.000webhost.com

Other information
Ka divergence:-0.541702KaKs divergence:-0.648193
GC content 1 (%):45GC content 2 (%):49GC content divergence:0.043
Length 1 (bp):312Length 2 (bp):312Length divergence:0
MFE 1 (kcal):-86.83MFE 2 (kcal):-95.3MFE divergence0.047