Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G19380-AT2G19385
Species:Arabidopsis
Duplication type:TD
Function (paralog1):RNA recognition motif (RRM)-containing protein
Function (paralog2):zinc ion binding

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.2387936082314
Log2 mRNA fold difference:2.7455867703316
Log2 TE fold difference:-0.49132988241748
Sequences
Protein sequence

MVWFQCDDCGENLKKPRLPRHMSMCTATKFSCIDCGNMFGQVSVHYHNQCITEAEKYGPM
VRSNGESSKQKHDFDINAELFNSQWFCSLCNATMTCEQDYFAHVYGKKHQEKANEVADMD
YSKQQSEHPAVDKNNLTQQPDLDIYVGLSNDYPWFCSLCDINATSEQTLLAHANGKKHRV
KVERFDAEQQKRQSTQHSTVDKKDYSKQQIEVDINVGLSNCYPWFCSLCNVKATCQQNLL
SHANGRKHRENVELFDATQQQQLEKTTVDKKDTTVNASDGNSEQKKVDLLVSSGVANGYS
QAHKKRKLETCDETWKREVVQAEEAKGGGEQKSESKKAKKQDKEKKRKKDKKQTKSDSDF
EHDKEDIKQLLVAYSKEELVNLIYKTAEKGSRLISAILESADRDIAQRNIFVRGFGWDTT
QENLKTAFESYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAREALKRPEKRMYNRIVVC
NLASEKPGKAGKEQDMAEPVNIDLTKMANQSEAVLPGIELGRGHVLEKMHHQQQQTMDMF
GQNMPFYGYSHQFPGFDPMYGALSGNQMLAGLPNYGMFGSGMMTNQGSMLPPPNHLGMAG
QYFGDGEQAWHQR

MVWFQCEDCGESLKKPKVPSHFKMCRANKLSCIDCGEMFGRDTVQGHNQCITEAEKYGPK
GQSKSANGTPAKPKDISKQEPDFDINVGLSNRYPWFCSLCNTKATSQQTLLAHADGKKHR
GKAKAFHARQQQEQSTTLDNKDGSENASNVDSEQKKVDLPASSGVANGESHPEKKRKLET
LDETSEGEEAKGSDLKKAKKQDHEKKINWKKLITSALKSNEDKTLKMKKLKKLVLESIVD
SGRDKSELKAELELKVNLSSRFTVDGKYVKLVAKD

www.000webhost.com

Other information
Ka divergence:-0.560969KaKs divergence:-0.558171
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):1842Length 2 (bp):828Length divergence:-0.38
MFE 1 (kcal):-533.59MFE 2 (kcal):-239.13MFE divergence-0.381