Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G19390-AT4G29790
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.24879901993741
Log2 mRNA fold difference:0.69857341459122
Log2 TE fold difference:-0.93088450144944
Sequences
Protein sequence

MSAPGKFDYSSGGLDRPLYRSNFAAQMERSSSFRESMEHPVPSHPIMLRTTSPIAQTDVT
NFFQCLRFDPKVVAADHKSIRQGDFKRHVSIALGILGDESPSGSLKGKFIPSPIPEEIKR
FKAGLRENNVKARERVKIFNEASSVFNKFFPSVPTKKRSRPEGFSGDRSGDRLVSGPGLG
KMGIQGQTLAGGFELDQQKLDERPKSGVPNKRTRTSMMDVRNNCIVRQSAAVDKDKEIMR
VGNHNAVQGEDRTSTGIDGWETSKMKKKRSSINADCHPNLASNKVVDGYRDLKQGIQQKP
TGDSRSRVNGDSNMFRQSAGNGATGYGRSDSLSHQTSLAGHSPLARVDSDHNSLYSEKRE
RSIVSDKERVNLRGVNKSNIHDEFNSSSLVSNTKTNASVRGPRSGSGLPPKLSPGLHNTP
SPIEWDISGCTNKPPTLSGVTQRKRMTSNRSSSPPVTQWASQRPQKISRIARRTNLVPIV
SSQDEVPYSDNISDVGCSETGFGFHKRSPAASPQLKLKGESSFSTAALSESEESGHPEIK
SKDKGKQSDEVDGKAAQNIPRVSIPALQSRKSNKPAAGEEIGDGVRRQGRTGRGFSSTRS
LNPNGVNKLKNVGTAKHLRSARPIFDKNESKVGRPPTRKLSDRKAYKRQRATATNAPTLD
FHVGSNDGREELLAAVNSAINIAQNFPNSFWKQMERYFGYISDDHINFLKQQGELSSMGP
TPVLTSSEFDSPVFPEELATSRADSKASPLYQRLLSALISEDSMGVNEDLQVDLDDDSEF
SVLNNMEFNGFRNNERLELDESENDGSAILFKGVDKSAHHCNGKFPDNSPIDFVDIQYDK
LGIDEKIYLEAQSLGISIDLMPSISNVEDEGIADEIKKLEEAICNEGSKKKEIVDRLLKP
AIEMKELQEKELDQLGYEKLIEMAYEKSKASRRHHNAGGKNSNNKISKQAALAFVRRTLE
RCHQFEKTGKSCFSEPEIKDMFIAGLATAEDTLMDKEYNTSTSTPMGSQPSSSLALIGQN
SENYAKSSDVLPSENALLEQTTGKEDTAWSNRVKKRELLLDDVGIGTQLSSNTKGKRSDR
DRDGKGQASSRGGTNKIGRPSLSNAKGERKTKAKPKQKTTQISPSVRVPEQPKPSLPKPN
EANSEYNNLEALEETEPILDLSQLQIPDGLGDFDAQPGDINSWFNMDDEEDFDMTELGIP
TDDISELNIKL

MSAPGKFDYSSGGPERPLYRSNLAAQMERSSSFRETMEHPVSSSHPSMLRSTSPIAQTDV
TNFFQCLRFDPKVVAADHKSIRQGDFKRHVNIALGIQGDESPSTPLKGKLIPSPIPEEIK
RLKAGLRENNVKARERLKIFNEASSVFNKFFPSVPTKKRSRPEGFSNDRSGDRLALGPGM
GKMGIQGQTLPGCFELDQQKLDERPKSGALNKRTRTSMMDVRSNAIVRQSAGVDRDKDTM
RLANHNAVQGEDRSSIGIDGWEKSKMKKKRSGIKTDGPSSLASNKAVDGYRDLKQGIPKL
AVDSRSRLNGDSNMLRHGAVNGAVPYGRSDSLSQQTGLAARSLLSRDSDHNPLYNEKRER
ATGSDKERVNLRAVNKSNIHDESNSSSPTSNLKISASVRGPRSGSGLPPKLSPVVHNTPS
PSDWDIAGCTNKPPLLSGVPNRKRMTSNRSSSPPVTQWASQRPQKISRVARRTNLVPIVS
SNDDIPSSDNMSDVGCSETSFGFYRRSPAASPQMKMKGENSLSTTALSGSEEFSPPEIKS
KDKGKQSDEVNGKTSQNVPKVSIPGLQSRKNKLASGEELGDGVRRQGRTGRGFASTRSVN
PMGVMKHGTAKQLRSARNGSDKNESRAGRPPTRKLSDRKAYKRQKNTATNATTLDFLDDG
HEELLAAVNSAINFAQNFPSSFWKQMERYFCFISDAHINFMKQQGELSFMGTTPGGTSSD
FDSHEIFPEELASSKVDSKAAPLYQRLLSALISEDSASVNEDLQFDGFGADVESEFSVLN
HMMEFNGYRSDRLEFDELEDDVSVIPLKGVNSSAHHVNGRLSDHLSIDFSDIQYETLGID
EKIYMEAQSIGICLDPMPSISNVEDEGIVDDIKTLEEAICEVVSKKKDMLNRLLKPALEM
KERQEKEFERLGYEKLIEMAYEKSKASRRHHSASGKSSATKISKQAAFAFVKRTLERCRQ
FEETGKSCFSESTFKNIIIAGLTQFEDNPTDKEDILSASTLMGSQPSSSLALPMTQSTEN
HANSSENALREGRDEMMWSNRMKKRELLLDDVGGKPLSSSTKGKRSERDRDGKGQASSSR
GGSTNKIGRPALVNAKGERKSKTKPRQKTTPMFSSSSTCVNIVEQTRTSLSKTTNSNNSE
YSNLETLDESEPLDLSHLQIPDGLGGPDDFDTQAGDLSSWLNIDDDALPDTDDLLGLQIP
MDDLSDLNMMV

www.000webhost.com

Other information
Ka divergence:-0.0564825KaKs divergence:0.33592
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):3636Length 2 (bp):3636Length divergence:0
MFE 1 (kcal):-1102.36MFE 2 (kcal):-1088MFE divergence-0.007