Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G19670-AT4G29510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):protein arginine methyltransferase 1A
Function (paralog2):arginine methyltransferase 11

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.6238625873996
Log2 mRNA fold difference:2.0598078667775
Log2 TE fold difference:-0.34276606692279
Sequences
Protein sequence

MTSTENNNNGSDETQTTKLHFEDADESMHDGDDNNADVADDITSADYYFDSYSHFGIHEE
MLKDVVRTKSYQDVIYKNKFLIKDKIVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADT
AKEIVKSNGFSDVITVLKGKIEEIELPVPKVDVIISEWMGYFLLYENMLDTVLYARNKWL
VDGGIVLPDKASLYVTAIEDAHYKDDKVEFWDDVYGFDMSCIKRRAITEPLVDTVDGNQI
VTDSKLLKTMDISKMAAGDASFTAPFKLVAQRNDHIHALVAYFDVSFTMCHKKMGFSTGP
KSRATHWKQTVLYLEDVLTICEGETITGSMTIAQNKKNPRDVDIKLSYSLNGQHCNISRT
HFYKMR

MTKNSNHDENEFISFEPNQNTKIRFEDADEDEVAEGSGVAGEETPQDESMFDAGESADTA
EVTDDTTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYQNKFLIKDKIVLDVGAGTGI
LSLFCAKAGAAHVYAVECSQMADMAKEIVKANGFSDVITVLKGKIEEIELPTPKVDVIIS
EWMGYFLLFENMLDSVLYARDKWLVEGGVVLPDKASLHLTAIEDSEYKEDKIEFWNSVYG
FDMSCIKKKAMMEPLVDTVDQNQIVTDSRLLKTMDISKMSSGDASFTAPFKLVAQRNDYI
HALVAYFDVSFTMCHKLLGFSTGPKSRATHWKQTVLYLEDVLTICEGETITGTMSVSPNK
KNPRDIDIKLSYSLNGQHCKISRTQHYKMR

www.000webhost.com

Other information
Ka divergence:-0.216258KaKs divergence:0.119876
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1101Length 2 (bp):1173Length divergence:0.032
MFE 1 (kcal):-312.4MFE 2 (kcal):-342.5MFE divergence0.046