Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G19680-AT4G29480
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Mitochondrial ATP synthase subunit G protein
Function (paralog2):Mitochondrial ATP synthase subunit G protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.60021119775297
Log2 mRNA fold difference:0.94075557575832
Log2 TE fold difference:-0.32193361319707
Sequences
Protein sequence

MASKLVQLQSKACQASKFVAKHGNSYYKQLLEQNKQYIQEPATIEKCSELSKQLLYTRLA
SIPGRYETFRKEVDYAKNLLKNRANLKVEDAGIAALFGLECFAWFCAGEIVGRGFTFTGY
YP

MASKLIQVQSKACEASKFVAKHGTSYYRQLLEKNKQYIQEPATVEKCQELSKQLLYTRLA
SIPGRYETFWKEVDYAKNLWKNRSGLKVEDAGIAALFGLECFAWYCAGEIAGRGFTFTGY
YP

www.000webhost.com

Other information
Ka divergence:0.194025KaKs divergence:-0.999851
GC content 1 (%):44GC content 2 (%):47GC content divergence:0.033
Length 1 (bp):369Length 2 (bp):369Length divergence:0
MFE 1 (kcal):-103.04MFE 2 (kcal):-105.43MFE divergence0.011