Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G19710-AT4G29440
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Regulator of Vps4 activity in the MVB pathway protein
Function (paralog2):Regulator of Vps4 activity in the MVB pathway protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.11296299214806
Log2 mRNA fold difference:-0.44150244292487
Log2 TE fold difference:0.51689767515817
Sequences
Protein sequence

MKKVLQRGFKPAKCKTALQMANSRLKILKNKKEIQIKQLRRELAQLLESGQTPTARIRVE
HVVREEKTVAAYELIGIYCELLVVRLGVIESQKNCPIDLKEAVTSVLFASQRLSDVPELS
EIFKQFTTKYGKDFSTSAVELRPDSGVSRLLVEKLSAKAPDGPTKVKILMAIAEEHNVVW
EAQSFVESDPKDTELLNGANSFQPASSMNMDSSINSNKEQPPNIHAPATVNAHHGSSERH
HSPENSYANGGRSSSRSNNVTSGKADDYYHSKARPSRSRPDEGECRNPNHGYENSSSRNK
QKWEPEFVDSTDAARAAAEAAERASFAARAAAELSNKERMTRQDSTQSHISSASVNLRNE
PSHRRDRSNAQRESFSEDHVSPRRNVRMQYEDMDRTRQDRYDRAEQIPPVDQPSGRHSVD
NSRNNGSFGREKQPSQDETDINVGYSEDVHLRKQSSRVSSHSHSSNYSDENDLGSDFMKS
PSIVEENIFATEYDHQSQSSFKDIDSHDHGHDDDAAATDNYDDYSSFFYQPKFHAEDNHY
QDEIDHGVGFSLLGSKTSASAASWSFKGDHSKSHGKHSSSSSQVFQENPSSRLFDDVSTS
PPASYHEPDPHAKFDNYGPNSESDGDQPIDKVSGDVHERGNLTSDRSHKFKVSDSAGHEV
FPLDTEEHTDNSRTREESDSDSEPQLGLRLGALAGGFRNKKTLPPYRMSSASSKAEKEYI
QIDDFGQSSRKDLYSKKASNTETRPSFMPPHPSSSDEDDSDMQHPGRTETKSDSLYSHSR
VNHDDSEEEKLPTRSSSRIQERSHKPSTGIRVQKRTNFKMPVSASSEDEEEVEREAARIN
AKPNKTTGYGFSLRTKGQSKANEKHSLPVTTKKTDKESHDQPSPRTVTSSHVPQTVKSPD
PDTPSRERERASHVHPNLPEYDDIFARLGALRAPSRR

MKKVLHRSFKPAKCKIALQMAASRLKILKNKKDTQIKQLRRELAHLLESGQTQTAKIRVE
HVVREEKTVAAYELVGIYCELLVARLGVIDSQKTCPNDLKEAVASVLYASQRLTDVGELS
DIVKHFSAKYGKDFVSAAIGLQPDSGVSRLLVEKLSVKAPDGPTKIKILTEIATQHNVTW
EAESLVESDPKETMSASGASSSVSQPATGIKSESSRIQNNQPPVFQAAATVNVSQNSYAT
DGRSSSRMTSTDFNVGKTPDHYHQDPKPSGDRVDGREHRDHNPGHGDTSPFETKFVDATS
AARAAAESAERASFAARRAAELSSKERMMMMQNSTESRNSSSYENLRSNPPHSRTSSSNM
QGGGFGKEELLKSNNRQVDQSTTTTRAESSKKTVDELSENTSWRRGHSRENSLEMRPNDS
FAKIGREKQQPGMDDINLSSSADVLNKKQSSRASSHSPSSNFSDDNDVTALDHIDSPSIF
EENKFQSTVGDRESYNDSPVVVVAPAFDDYSSFFDKPQFDTEDAYHDEPEQGLGFSLLGS
SSKTSDHMPTEISSWSLEGHKDLGKLSSASTSQVLEKEKPSSPPTFDDGPTSPPASLHEP
EPSAKFDDYDRDSESEEDNLGRLSGRAEGKSKLTAQKSHMSEGPDDLGRYFFPSDTEDQG
DDSKTQEESDAETPTGLKFGPLASGLENETTLPSYGSSPPRDKTSSKSIKEYLPTEVDPS
RSSSLQTASSSSIRNELYTQKASNSDKRPSSIPPDSSSSDDESDMELPKRVSFRYQEKRT
ESRTRPTHLHSGVSHKDLEEEIPTRASTRSQDRRTHKTTPASASASYFHTMSSDDEDEKE
VHRDTAHIQTRPYISISRRTKGQERRPSLVTAKIDKVSFDEESPPKLSPEAKPLTKQQGS
ASSLSYLPKTEKVSHDQESHPKLGLGAKPLIKQQGSASSLSFLPKTNKASPDQDSPPKLV
PKEKPAAKQRGSASSLSFLPKTDKASPDQDSPPKLLPKEKPAAKQQGSATSSSSLPKTEK
ISHYRESPSKLTPEAKSMAKQEGLASSSSSLPKTVTSPDPETPAKEKASHVHPKLPDYDD
IFAKLGALRR

www.000webhost.com

Other information
Ka divergence:0.226866KaKs divergence:0.019829
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):2814Length 2 (bp):3273Length divergence:0.075
MFE 1 (kcal):-813.85MFE 2 (kcal):-932.99MFE divergence0.068