Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G19720-AT4G29430
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ribosomal protein S15A B
Function (paralog2):ribosomal protein S15A E

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.1048215231682
Log2 mRNA fold difference:1.4251440553225
Log2 TE fold difference:-0.27813007609379
Sequences
Protein sequence

MGRRILNDALRTIVNAEKRGKASVELKPVSTVMSSFLKIMKEKGYIKNFQVHDPHRVGRI
TVDLQGRVNDCKALTYRQDVKANEIGQYTERTLPTRQWGYIVITTPDGILDHEEAIKRNV
GGQVLGFFH

MGRRILNDALRTIVNAERRGKASVELKPISTVMSSFLRIMKEKGYIKNFQVYDPHRVGRI
TVDLQGRVNDCKALTYRQDVRAKEIEKYTERTLPTRQWGYVVITTPDGILDHEEAIKRNV
GGQVLGFFY

www.000webhost.com

Other information
Ka divergence:-0.147784KaKs divergence:-0.521992
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):390Length 2 (bp):390Length divergence:0
MFE 1 (kcal):-113.8MFE 2 (kcal):-105.3MFE divergence-0.039