Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G19760-AT4G29350
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):profilin 1
Function (paralog2):profilin 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.3956273281814
Log2 mRNA fold difference:1.0188902134426
Log2 TE fold difference:0.44644194082306
Sequences
Protein sequence

MSWQSYVDDHLMCDVEGNHLTAAAILGQDGSVWAQSAKFPQLKPQEIDGIKKDFEEPGFL
APTGLFLGGEKYMVIQGEQGAVIRGKKGPGGVTIKKTNQALVFGFYDEPMTGGQCNLVVE
RLGDYLIESEL

MSWQSYVDDHLMCEVEGNHLTHAAIFGQDGSVWAQSSAFPQLKPAEIAGINKDFEEAGHL
APTGLFLGGEKYMVVQGEAGAVIRGKKGPGGVTIKKTTQALVFGIYDEPMTGGQCNLVVE
RLGDYLIESGL

Other information
Ka divergence:0.213642KaKs divergence:-0.406981
GC content 1 (%):49GC content 2 (%):53GC content divergence:0.039
Length 1 (bp):396Length 2 (bp):396Length divergence:0
MFE 1 (kcal):-125.6MFE 2 (kcal):-145.8MFE divergence0.074