Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G19780-AT4G29240
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Leucine-rich repeat (LRR) family protein
Function (paralog2):Leucine-rich repeat (LRR) family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.2009938873809
Log2 mRNA fold difference:-0.045202178949243
Log2 TE fold difference:1.3546219815649
Sequences
Protein sequence

MKKKGTNNNNFSLLSLSLFLNCLILTNGYSIGVGVGIGGGDGDDGGVWIGGGNPNSNPGS
APNQQQTTNAAYNALQSWKSAITEDPSGVLKTWVGEDVCSYRGVFCSGSSITSIDLNKAN
LKGTIVKDLSLLSDLTILHLNSNRFSGQIPDSFKNLDSLQELDLSNNRFSGSFPQVTLYI
PNLVYLDLRFNNFTGSIPENLFNKQLDAILLNNNQFTGEIPGNLGYSTASVINLANNKLS
GEIPTSFGITGSKLKEVLFLNNQLTGCIPESVGLFSDIEVFDVSFNSLMGHVPDTISCLS
EIEVLNLGHNKFSGDLPDLVCTLRNLINLTVSFNFFSGFSSQCSSLSVGFDFTGNCIPGK
GYQRPQPDCSAIPGGQLSCFRIPAQPLTCAAISLGLKVASSP

MSKKKKGSNNFKLLCFFLFLGGLVQTDASFGVGGGVGVGIGGGGGGGGGGVWVGGGYNNG
GNRNAVPGSSAPNRVAYNALQVWKSAMREDPSNVLKTWVGSDVCSYKGVFCSGQSITSID
LNHANLKGTLVKDLALLSDLNILHLNSNRFSGQIPDSFKSLASLQELDLSNNKLSGPFPL
VTLYIPNLVYLDLRFNSLTGFIPEELFNKRLDAILLNNNQFVGEIPRNLGNSPASVINLA
NNRFSGEIPTSFGLTGSRVKEVLLLNNQLTGCIPESVGMFSEIEVFDVSYNALMGHVPDT
ISCLSAIEILNLAHNKFSGEVPDLVCSLRNLINLTVAFNFFSGFSSECSSRVSFGFDFVG
NCIPGRNSQRPQPDCSGYSGGAMSCFRIPTQPLACAAISVGLRESNNQYYTSSPP

Other information
Ka divergence:0.0294652KaKs divergence:-0.254876
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1209Length 2 (bp):1248Length divergence:0.016
MFE 1 (kcal):-341.82MFE 2 (kcal):-379.71MFE divergence0.053