Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G19810-AT4G29190
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CCCH-type zinc finger family protein
Function (paralog2):Zinc finger C-x8-C-x5-C-x3-H type family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.0013170203417
Log2 mRNA fold difference:1.5087099770217
Log2 TE fold difference:-0.66228870294766
Sequences
Protein sequence

MMIGESHRGFNPTVHIPPWPLSEDLTVSDIYGSPDGGSSMMEALAELQRYLPSNEPDPDS
DPDLSGPDSPIDAYTCDHFRMYEFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKFHYS
GTACPEFRKGCCKRGDACEFSHGVFECWLHPARYRTQPCKDGGNCRRRVCFFAHSPDQIR
VLPNQSPDRVDSFDVLSPTIRRAFQFSISPSSNSPPVSPRGDSDSSCSLLSRSLGSNLGN
DVVASLRNLQLNKVKSSLSSSYNNQIGGYGSGFGSPRGSVLGPGFRSLPTTPTRPGFMNI
WENGLEEEPAMERVESGRELRAQLFEKLSKENCMGRIEPDPDQGAGDTPDVGWVSDLVM

MMIGETRRTYPTVEIPPWPVLEELTTSEFFSPVMNSPDCSMLEALAGLQRYLPSNEPDPE
SYPDLLGPDSPIDAYSCDHFRMYDFKVRRCARGRSHDWTECPYAHPGEKARRRDPRKYHY
SGTACPDFRKGGCKKGDSCEFAHGVFECWLHPARYRTQPCKDGGNCLRKICFFAHSPDQL
RFLHTRSPDRVDSFDVSSPIRARAFQLSISPVSGSPPMSPRADSESSPMTQSLSRSLGSC
SINDVVPSFRNLQFNSVKSFPRNNPLFGFGSPRGSILGPGFQSLPTTPTRPGNLDIWEYG
LEEEPVMERVVESGRELREKMREKLHKENCMDRVAQDPDQNLGEAPDVGWVSDLLM

Other information
Ka divergence:0.0110571KaKs divergence:0.439595
GC content 1 (%):50GC content 2 (%):49GC content divergence:-0.01
Length 1 (bp):1080Length 2 (bp):1071Length divergence:-0.004
MFE 1 (kcal):-404.72MFE 2 (kcal):-372.19MFE divergence-0.042