Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G19830-AT4G29160
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SNF7 family protein
Function (paralog2):SNF7 family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.27195758732181
Log2 mRNA fold difference:-0.22273180124202
Log2 TE fold difference:0.012378226262376
Sequences
Protein sequence

MFMNRLFGKPKQETSTLQTLDKLNETLEMLEKKENVLLKKATGEVEKAKEFSRAKNKRAA
IQCLKRKRLYEQQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRTGASAMKAMQKATNI
DDVDKTMDEINEQTENMKQIQEALSAPFGANDFDEDELEAELDELEGAELEEQLLQPVPI
HVPQGNKPARAPAQKQPTAEEDELAALQAEMAL

MMNRLFGKPKQEANALQTLDKLNETLEMLEKKEKVLLKKAGAEVEKAKEYSRAKNKRAAI
QCLKRKRLYEGQVEQLGNFQLRIHDQMIMLEGAKATTETVDALRSGASAMKAMQKATNID
DVDKTMDEINEQTENMKQIQEALATPMGAAADFDEDELAAELDELESEELESQLLQPATT
APPLPSVPVPAGRQPARPVPQKRTAEEEELAALQAEMAL

Other information
Ka divergence:0.0245764KaKs divergence:0.162643
GC content 1 (%):43GC content 2 (%):47GC content divergence:0.044
Length 1 (bp):642Length 2 (bp):660Length divergence:0.014
MFE 1 (kcal):-182.62MFE 2 (kcal):-191.44MFE divergence0.024