Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G19860-AT4G29130
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):hexokinase 2
Function (paralog2):hexokinase 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.3914152894454
Log2 mRNA fold difference:0.91450050702549
Log2 TE fold difference:0.4961988835122
Sequences
Protein sequence

MGKVAVATTVVCSVAVCAAAALIVRRRMKSAGKWARVIEILKAFEEDCATPIAKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKHDR
VVKREFKEESIPPHLMTGKSHELFDFIVDVLAKFVATEGEDFHLPPGRQRELGFTFSFPV
KQLSLSSGTLINWTKGFSIDDTVDKDVVGELVKAMERVGLDMLVAALVNDTIGTLAGGRY
TNPDVVVAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEYDH
SLDVDSLNPGEQILEKIISGMYLGEILRRVLLKMAEEAAFFGDIVPPKLKIPFIIRTPNM
SAMHSDTSPDLKVVGSKLKDILEVQTSSLKMRKVVISLCNIIASRGARLSAAGIYGILKK
IGRDATKDGEAQKSVIAMDGGLFEHYTQFSESMKSSLKELLGDEVSESVEVILSNDGSGV
GAALLAASHSQYLELEDDSETS

MGKVAVGATVVCTAAVCAVAVLVVRRRMQSSGKWGRVLAILKAFEEDCATPISKLRQVAD
AMTVEMHAGLASDGGSKLKMLISYVDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQER
VVKQEFEEVSIPPHLMTGGSDELFNFIAEALAKFVATECEDFHLPEGRQRELGFTFSFPV
KQTSLSSGSLIKWTKGFSIEEAVGQDVVGALNKALERVGLDMRIAALVNDTVGTLAGGRY
YNPDVVAAVILGTGTNAAYVERATAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEFDH
TLDFESLNPGEQILEKIISGMYLGEILRRVLLKMAEDAAFFGDTVPSKLRIPFIIRTPHM
SAMHNDTSPDLKIVGSKIKDILEVPTTSLKMRKVVISLCNIIATRGARLSAAGIYGILKK
LGRDTTKDEEVQKSVIAMDGGLFEHYTQFSECMESSLKELLGDEASGSVEVTHSNDGSGI
GAALLAASHSLYLEDS

www.000webhost.com

Other information
Ka divergence:-0.0283688KaKs divergence:0.154786
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1509Length 2 (bp):1491Length divergence:-0.006
MFE 1 (kcal):-471.56MFE 2 (kcal):-488.17MFE divergence0.017