Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G19910-AT2G19920
Species:Arabidopsis
Duplication type:TD
Function (paralog1):RNA-dependent RNA polymerase family protein
Function (paralog2):RNA-dependent RNA polymerase family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.2552334480129
Log2 mRNA fold difference:-0.61443354090413
Log2 TE fold difference:-0.6811989181727
Sequences
Protein sequence

MMNNGCDEVSPRSEIALLGSVETMLEKIYEKHNHRLPISVETRRKLSSISEELALETLRK
VFNKPYLKTLDGLIMYFVKGTVTVDGSPRLSPGESPVQSPRTPAKKSCRASQDVSLDLET
PSPKFMKREENGGSKYIPPLLALGELEFKKAFLLLSYIGGESLVEEVISGDQIRKWKDLP
MVSYEAAVWNRLGQRYCSPKERRRPLEGDSGMTHYYQCHVATDGSYKFKGHLLENTGTHL
HKVLGDDNVLTVKFDKVLGVETYCNDLYSTYKGIAKNGIMVGLRRYRFFVFKDGGKEEKK
KDVSTKGVKCYFIRTDSTASIDMQNPYIFAGKSMHEARMHFMHVNTLSSLPNYMSRFSLI
LSKTKTLEVDMTGITFEQIDDIHCHDQDDKDVLDKNGKPCIHSDGTGYISEDLARMCPVN
IFKGKSMRSNNIQSKNLNFEGQGPCGQEPPLLIQFRIFYNGYAVKGTFLTNKKLPPRTVQ
VRPSMIKVYEDRTLSNLSTFNSLEVVTTSNPPRKARLSRNLVALLSYGGVPNDFFLNILR
NTLEESKTIFYSERAAFKAAINYGDDQYTADMILVGIPLDEPYLKDRLSYLLKTERNALK
AGRFPIDESYYIMGTVDPTGELKENEICVILHSGQISGDVLVYRNPGLHFGDIHVLKATY
VKALEDYVGNAKFAVFFPQKGPRSLGDEIAGGDFDGDMYFISRNPKLLEHFKPSEPWVSS
SKPSKIYCGRKPSELSEEELEEELFKMFLKARFCKRDVIGMAADCWLGIMDPFLTLGDES
AKEKYERKKNILKLIDIYYDALDAPKKGAKVDLPPDLEIKNFPHYMERDPKRDFRSTSIL
GLIFDTVDSHNAEEPPPSEISKLWYFEDEPVPKSHMDKFTSWYENYRSEMSQAMMETDKV
KRNQLTNEVIQRYKQDFYGAAGFEDSNKSLEELYPQALALYNVVYDYAIQEGVAKCTFAW
NVAGPVLCKFYLKKTKDKSVVASTSVLKKLLG

MMTTTMDYNSSDQGFSWSEIALLGSVETMLEKVYGKHNHHPPIKVETRRRLSSISEELAL
ETLRKVLNMPNVKTLDGIIIYFLNDAVTVDGSPRLWSGESPVQFPRTPGKKSCRASQAEV
SLDREDPSPKFLRGDENGESKHISLLLALGELEFKKAFLLLTYLGGKSLGEVISGDEIRQ
WKDLPMVAYERAVWFKLGQNEERMQLESDSGKTHYYQCHVAPDGSYRLKGYFLENTGTHL
HKVLGDDNVLTVRFDQLPKESTYCDNPYSKYKEIAKNGIMVGLRRYQFFVFKDGGKAEKK
KRNSTKQVKCYFIRTGSTASSDMENPYILSGMSIHEARMHFMHVHTLPSPANYMARFSLI
LSKTKKLEVDMTEITVMQIDDIHCHDQSNNDVLDKNGKPRIHSDGTGYISEDLARMCPLN
IFKGKSMRSNNIQGTCVQEPPLLIQIRMFNDGSAVKGIFLLNKNLPPQTVQVRPSMIKVY
KDKNLSNFSTFNSLEVVTTSNPPKRAKLSKNLVALLSYGGVPNDFFLDILLNTLEKKKTI
FFKVRAAGKAALHYGNMDDKNALQMIMAGIPLDEPYLKHYLSKLLKLEKDDLKAGKLPID
ESYYLMGTVDPTGELKEDEVSGLAKSQDVLVYRNPGLHFGDIHILKATYVKSLEQYVGNS
KYGVFFPQKGPRSLGDEIAGGDFDGDMYFISRNPKLLEHYKPSEPWVSSSPRSKIYTGRQ
PSELSPEQLEEELFKIFLKTGFSPSSVIGQAADSWLAIMDRFLTLGDENVKEKAEMKKKM
LKLTDIYYDAIDAPKTGTEVNLPLDVKVDLFPHYMERNKTFKSTSILGLIFDTVDFHNAE
DTTPSGISKLQCFEDEPVSEFDMEKCKLWHKDYRKEMCQAMNSDDDDSCNEVIQKYKQEF
YSAAGFKESKKILEELYPKALALYNVT

www.000webhost.com

Other information
Ka divergence:0.235132KaKs divergence:0.409105
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):2979Length 2 (bp):2784Length divergence:-0.034
MFE 1 (kcal):-871.59MFE 2 (kcal):-808.95MFE divergence-0.037