Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20030-AT4G28890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.1110967651833
Log2 mRNA fold difference:2.3358364758529
Log2 TE fold difference:-0.22340493037012
Sequences
Protein sequence

MNSPQEISILFFFIIFLDYVSAQSPPPPNLYATSDLFKPSLAIITGVFSIVFTLTFVLLV
YAKCFHNDLRSETDSDGERIRHDRLWQGLFNRSSRFSGLDKKAIESLPFFRFSALKGLKQ
GLECSVCLSKFEDVEILRLLPKCRHAFHIGCIDQWLEQHATCPLCRNRVNIEDDLSVLGN
SSTSLRILNQSETREEDSRLEIYIEREEGTNDGSSRFSSFRKILKKSLLLEREGNENIDE
KKLMHKFNHRIVVSDAVFKNRWSNITSSDLTFLTSEMLNSVSSDRFSSVDRVHRGNLRDK
EDMEMKRMLIKHKDSSRRTVSEITTVSREKAVGGSYRGSTASTSQNYAVTATTEERRRRL
WLPIARRTAQWFVNREKSNDLNTTRQNLNV

MYQIFFFFLPLLHSYASAQTPPPFRNGDLVANFEPSLAVVTGVLAIMFALTFVLLVYAKC
CHIDLRSGSGDRRRHDRRLRQGIFFNRSTASSDRFSGLDKTAIESLPLFRFSALKGSKQG
LDCSVCLSKFESVEILRLLPKCRHAFHIGCIDQWLEQHATCPLCRDRVSMEEDSSVLTNG
NSFRFLNQSEIREDSSLELYIEREEEEERIHREELSGSSRFSIGESFRKILKLGNKEKTL
LDEHVNDKDEKKLMHKFNHRIVVSDVVFKNRWSNVSSSDLMFLNSEMVNSISSERFSSLD
HVKRGDEEDQIGILRIKEEMEAKRMLENKLTSMTTMFSSENGDSGSKSRSVMIEPGRRSV
SDITAVPRLSISIHGDCSGSAAETASALQNGGNETEERRRRLWLPIARKTAQWFANREKR
SQINTTHQHFDV

www.000webhost.com

Other information
Ka divergence:-0.327789KaKs divergence:-0.21146
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1173Length 2 (bp):1299Length divergence:0.051
MFE 1 (kcal):-324.52MFE 2 (kcal):-387.56MFE divergence0.089