Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20100-AT4G29100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):basic helix-loop-helix (bHLH) DNA-binding superfamily protein
Function (paralog2):basic helix-loop-helix (bHLH) DNA-binding superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.0531874715736
Log2 mRNA fold difference:2.2145151603298
Log2 TE fold difference:-0.28900911456926
Sequences
Protein sequence

MNRGVLESSPVQHLTAAGNPNWWNNVSRGLRPPTPLMSHEPPSTTAFIPSLLPNFFSSPT
SSSSSSPSFPPPNSNPNFSSWLEMSDLPLDQPWSLSQLLLGGLMMGEEEKMEMMNHHHHQ
NQHQSYQAKRIQNWEEQVLRHQASMKQESSNNNSYGIMSSPNSPPNKSCATIINTNEDNN
NNIHSGLNLSECNSSEMIGSSFANKKPKLQVPSSQSTLKVRKEKLGGRIASLHQLVSPFG
KTDTASVLSEAIGYIRFLHSQIEALSLPYFGTPSRNNMMHQHAQRNMNGIFPEDPGQLVN
EYCMKRGVSLSSTDNQKSNPNEEPMKDLRSRGLCLVPISCTLQVGSDNGADYWAPAFGTT
LQ

MNRGVLESSPVQQLMAAGNPNWWNVSGGMRPPPPLMGHQQAPLPPHMTPNNNYLRPRMMP
TPFPHFLPSPATSSSSSSSSPSLPNNPNLSSWLESNDLPPESWSLSQLLLGGLMMGEEER
LEMMNHHNHHDEQQHHGFQGKIRLENWEEQVLSHQQASMVAVDIKQEGNINNNNGYVISS
PNSPPNKSCVTTTTTTSLNSNDDNINNNNNMLDFSSNHNGLHLSEGRHTPPDRSSECNSL
EIGGSTNKKPRLQPSPSSQSTLKVRKEKLGGRIAALHQLVSPFGKTDTASVLSEAIGYIR
FLQSQIEALSHPYFGTTASGNMRHQQHLQGDRSCIFPEDPGQLVNDQCMKRRGASSSSTD
NQNASEEPKKDLRSRGLCLVPISCTLQVGSDNGADYWAPALGSAGFH

Other information
Ka divergence:-0.536249KaKs divergence:-0.446389
GC content 1 (%):43GC content 2 (%):47GC content divergence:0.044
Length 1 (bp):1089Length 2 (bp):1224Length divergence:0.058
MFE 1 (kcal):-317.8MFE 2 (kcal):-383.8MFE divergence0.094