Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20110-AT4G29000
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tesmin/TSO1-like CXC domain-containing protein
Function (paralog2):Tesmin/TSO1-like CXC domain-containing protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.4669707016341
Log2 mRNA fold difference:0.68187588216364
Log2 TE fold difference:0.63285448731017
Sequences
Protein sequence

MGEGEEGDKFPPKTDEVTQESMKSARQLDFTGGSSDVEHSHSNQASSMAAASIPSPIVTV
TRPIITSQAPPTVATPIPPPPQSQGIILHVPIRHPRPESPNSMPRPAGETRDGTPQKKKQ
CNCKHSRCLKLYCECFASGTYCDGCNCVNCFNNVENEPARRQAVESTLERNPNAFRPKIA
ASPHGGRDNREEVGDVVMLARHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNFE
GSEVRQSLFHGEHSHNLAYLQHANAAITGAIGSSGFASAPPPKRRKGQEIFFNQGTKDSS
THRLGQANNGRTTSSQTGSRAGGNASLGPSKVVYKSLLANIIKPMDVKALCSVLVAVAGE
AAKTLTEKRLANQKETSVASSVQDQGHVNNKAEKSGLEDSNADGSKGRSLSPETLALMCD
ERDTMLMVAASPNCSVEPTSQLPNGQDQVYAEQEKVVLTKFRDCLNRIISCGEVKVFCLF
VAESNCSMSRMDLDTPVQTTVRIDPVVQQAPVANGVSQTAKQPSQLNTTTPNTSSQTANG
VSQTAKQPSQLTTTTTTPNTSSQTHLHKTPALSEKKDL

MGEDGGGGEFPPKKDGVEEGFPTKKPARQLDFTGGSDEHSLSKPAAPTVVATSVKPIISS
SVPSTIRPGMTIAIGQVTQVRPTLPMATTMSNPPSQSQIVNAPIRHPIPESPKARGPRPN
VEGRDGTPQKKKQCNCKHSRCLKLYCECFASGTYCDGCNCVNCFNNVDNEPARREAVEAT
LERNPFAFRPKIASSPHGGRDKREDIGEVVLLGKHNKGCHCKKSGCLKKYCECFQANILC
SENCKCLDCKNFEGSEERQALFHGEHSNHMAYLQQAANAAITGAVGSSGFAPSPAPKRRK
GQEILFNQAIKDSSRLSHFPQVNNGRTGGPTSGTSPSPVSRAGGNASSVPSKFVYRSLLA
DIIQPHDVRALCSVLVTVAGEAAKTSTDKRNEIENRVDDQTETSLASSAQDQPQGNNNAA
DVEMVATDHNQADKSGPEESNSDGVDASKVTPLSPATLALMCDEQDTIFMVAAPSPNGSV
DPNGCRPNSQGQSEIYAEQERLVLTKFRDCLNRLISYAEIKESKCLSLARMHIQPPAIAT
VKTENGIQQQVPIVNGASRTNCQPTLNKPQPMQLMNTTSAAPATATNTQHLQKPPALSEK
KDP

Other information
Ka divergence:-0.094071KaKs divergence:-0.391649
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1737Length 2 (bp):1812Length divergence:0.021
MFE 1 (kcal):-507.16MFE 2 (kcal):-534.06MFE divergence0.026