Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20120-AT2G20130
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Protein of unknown function (DUF502)
Function (paralog2):like COV 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.10122954571022
Log2 mRNA fold difference:-1.3415016968162
Log2 TE fold difference:1.4128290805295
Sequences
Protein sequence

MGDEKPVIVMANRERDRELLIPVADSGDKDDGSSSKPSSSSSASSSSHQSSHETLSLFIR
GWASKKFMTGCVILLPIAITFYITWWFIHFVDGFFSPIYAQLGINVFGFGFLTSIAFIFL
VGVFMSSWLGASVLNLGEWFIKRMPFVRHIYNASKQISTAISPDQNTQAFKEVAIIRHPR
VGEYAFGFITSTVVLQNYPTEEELCCVYVPTNHLYIGDLLLVNSNDVIRPNLSVREGIEI
VVSGGMSMPQILSTVDKPLASIDRATSL

MANRERDRELLIPVADFGDKDDGSSSKPSSSSSASSSHQSGHETLSLFIRGWASKKFMTG
CVILLPIAVTFYTTWWFIHFVDGFFSPIYALLGINIFGFGFLTSIAFIFLVGVFMSSWLG
ASVLNLGEWFIKRMPFVRHIYNASKQISTAISPDQNTQAFKEVAIIRHPRVGEYAFGFIT
STVVLQNYPTEEELCCVYVPTNHLYIGDILLVNSNDVIRPNLSVREGIEIVVSGGMSMPQ
ILSTLDKPLASIGNES

www.000webhost.com

Other information
Ka divergence:-0.0962604KaKs divergence:0.0602698
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):807Length 2 (bp):771Length divergence:-0.023
MFE 1 (kcal):-237.84MFE 2 (kcal):-226.06MFE divergence-0.025