Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20140-AT4G29040
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):AAA-type ATPase family protein
Function (paralog2):regulatory particle AAA-ATPase 2A

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.1907909080441
Log2 mRNA fold difference:0.73387328355356
Log2 TE fold difference:0.40114082211991
Sequences
Protein sequence

MGQGPSGGLNRQGDRKPDGGEKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPSTK
CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELID
ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVE
KAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK
AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDA
NSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPD
IKTRRRIFQIHTSKMTLAEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHV
DFKKAKEKVMFKKKEGVPEGLYM

MGQGPSGGLNRQGDRKPDGGDKKEKKFEPAAPPARVGRKQRKQKGPEAAARLPTVTPSTK
CKLRLLKLERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELID
ENHAIVSSSVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMVSVMKVE
KAPLESYADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGKTLLAK
AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGTKRYDA
HSGGEREIQRTMLELLNQLDGFDSRGDVKVILATNRIESLDPALLRPGRIDRKIEFPLPD
IKTRRRIFQIHTSKMTLSEDVNLEEFVMTKDEFSGADIKAICTEAGLLALRERRMKVTHP
DFKKAKEKVMFKKKEGVPEGLYM

www.000webhost.com

Other information
Ka divergence:-0.198413KaKs divergence:0.396825
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1332Length 2 (bp):1332Length divergence:0
MFE 1 (kcal):-408.14MFE 2 (kcal):-410.44MFE divergence0.003