Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20230-AT4G28770
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tetraspanin family protein
Function (paralog2):Tetraspanin family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.99774349153297
Log2 mRNA fold difference:-0.074245638727157
Log2 TE fold difference:-0.91303878717783
Sequences
Protein sequence

MRRNCCHVSFASTLKILNFVQAFIGVSIIIYSIWMLHEYSRHLPVDPPPSASSSSGTEIA
TSVSEPLKNPIDFVASIILGSNGGDHGFNLRSLDLPAPWFIYSFMAVGILVCIVTFIGFI
AAEAINGCCLCFYSILKTLLILLEAALVAYIAIDRHWEKDLPYDPTGELSSLRAFIEENI
DICKWVGIAVVAVQLLSLLLAMVLRAMVSTPKPELDEEEDDENPRSRTWDPLLGPQGNQA
PAGSSKIENWSSRIREKYGLNQSPPVNPKG

MSSSEYILSVKTTFFCFVRNHQRLFLRRSLLRSLISISRIVIEKMRHNCCHVSFASILKI
LNFLQAFIGISIIIYSIWMLDQYNHHVPVDPPPSQPPAASSPDSSYSFSNSIIEINSVSD
SLKNPIDFVSGIVLGSGGGDSGFNLRSLDLPAPWFIYCFMAIGILVCIVTIIGFIAAEAI
NGCCLCFYSILKTLLIIIEAALVGFIVIDRHWEKDLPYDPTGELNSLRAFIEENIDICKW
VGIVVVAIQLLSLLLALVLRAMVSPRQSELDDEDDFENPMSRARDNLLGPQANQTSSGSS
NIDNWRSRIREKYGLINSQSHTPSA

www.000webhost.com

Other information
Ka divergence:-0.0548437KaKs divergence:-0.109508
GC content 1 (%):46GC content 2 (%):42GC content divergence:-0.045
Length 1 (bp):813Length 2 (bp):978Length divergence:0.092
MFE 1 (kcal):-254.3MFE 2 (kcal):-280.06MFE divergence0.048