Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20240-AT4G28760
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF3741)
Function (paralog2):Protein of unknown function (DUF3741)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.9320935810804
Log2 mRNA fold difference:2.0669291661931
Log2 TE fold difference:-0.14968505574762
Sequences
Protein sequence

MPDLRPGVFSKSKETSTESMKKLIAREMSKDVVEDRQSSNNVVAKLMGLETSAPRSRSKS
SSRCSLTCVGSKEAGKHHREDETWDQKASNLSSKASMSDKQMDLVRRKFMEAKHLVTDDR
LHRSSELQEALQVLSSNKDLFVKFLQESNSLFPQHLSDFQPVPPHPDAKRITVLRPSKAV
GVQKCLAEDSKKPASLNQETGWIDAVQPTRIVVLKPSPGKSLDIKAIASSPPYFDEAGDA
ETREVAKEITRQIRETVEGHCRNETLSSSSSSVLSNGYMGDDCSLNRSNYEYLVGNITNS
EIMSPSSRHSWDCANKFESPFSSSSLSRVSFSPDSSVYREAKKRLSERWAMMSLNGDTQQ
PKNFPKVSTALGEVLALSETKVPTGSSEETNKVKQETRRSISCIGSGLDQVESTSDSLNI
LERSRSVPEIRLNGGTSKAQAPQELTESRSLKSSWKVSSLFFFRNKKSNKDKTFAPSQLA
IHRDAFQEQRIFTSEGDVENENQDQPSPVSVLQPAFEEECSGSVKPKTTQGEEMSLKSNL
IDKSPPIGTIARILAWEDESYTDTSKPAMGIEEDEDWYGFIKTLLTASGFSGSDSLMTRW
HSLESPLDPSLRDKFANKELIKRRKQRSNRKLVFDCVNAIITETTSTLAHTGLTKGFNML
EHVWTELQEWAVNDEVAGKMWSYGLQVEMNNLGIEIEVILLQELVEEAVFDLI

MNELRGRKAQKIESPVPGCLGKMVNLFDLGIAVNGNKLLTDKPHLDGSSLSRSRSDVTRM
PGPSYKGHSEAELIMSDLRRSASSKLSGTPMKKLIAREMSKEVEHKQSPTNVVAKLMGLE
TLPQTHQETATQRSKSRSNSHSSLNHSMTSTDNEVQKYQDFSREFKDVYETWQSPQKVSR
SRDCSPRKGRYDESTTEKQMALVRQKFSEAKRLVTDDSLHQSKEFQDALEVLSSNKDLFV
QFLQESNSFSQQNLSDFHHVPPHSEAKRITVLRPSKAGETEKYVVQGRRNKQVKKLASSS
QETGWGNRDLGYPSPYVNRGTEEHTVQPTRIVVLKPSLGKSLDIKAVSSSQSSPRGLHSR
GYFDEPEDVETKEVAKEITRQVRENLMGHHRNETQSSSVLSNGYIGDDSSFNKSDNEDLV
GNLSDSEIMSPASRHSWDCPNRFDSLFSPSSFSRASFSPESSVCREAKKRLSERWALMSV
SGRTQPLKHVSRTSSTLGEMLALTETKVTTESGEGSYEIVPATRVSTSCITSDLSQVEMA
SDSLNILARSKSVSDVRLNGETSVLGSSKVQAPRELTKTGSLKSSWKVSNLFFFKNNKAS
KEKRDASQCSSMSQLAAPSPVTLTGKTSEDCVFPIDCLPPVSSEQQSIILGEEEVTTPKP
LATGNTSENQDQPSPISVLFPPFEEECASIPECSGSTKHWSSQGDEMSLKSNLIDKSPPI
GSIARLLSWDDDSCTDNIAKPAMGVHEEEDWHLFIEMILTAAGFSSGCIVSHDPIMSRWH
MPNSPLDPSLRDKYTNPDNNNIKEFIHEGKRRQQRSTRKLIFDRINSIVSETTTTRTGNG
SLHFDLVEHVWAQLKDWVSDEPSKRDSGEDMDANSLAAESLVKDEIVGRTWTHSLQVEID
DFGIEIEKRLLQELVEEAVIDLTR

Other information
Ka divergence:-0.0951671KaKs divergence:-0.17766
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):2142Length 2 (bp):2775Length divergence:0.129
MFE 1 (kcal):-637.7MFE 2 (kcal):-838.51MFE divergence0.136