Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20260-AT4G28750
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):photosystem I subunit E-2
Function (paralog2):Photosystem I reaction centre subunit IV / PsaE protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.565912492741
Log2 mRNA fold difference:1.1611092779926
Log2 TE fold difference:0.11790520056274
Sequences
Protein sequence

MAMTSAATGFILTANVPAAIGGGSSKSTTIVSFLPMRSFGSRLVVRAAEDTPPATASSDS
SSTTAAAAPAKVPAAKAKPPPIGPKRGSKVKILRKESYWYKNVGSVVAVDQDPKTRYPVV
VRFAKVNYANISTNNYALDEVEEVK

MAMTTASTVFVLPANVTSVAGASSSRSSVSFLPMRNAGSRLVVRAAEDPAPASSSSKDSP
AAAAAPDGATATKPKPPPIGPKRGSKVKILRRESYWFKNVGSVVAVDQDPKTRYPVVVRF
AKVNYANISTNNYALDEVEEVAA

www.000webhost.com

Other information
Ka divergence:0.0454913KaKs divergence:0.14877
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):438Length 2 (bp):432Length divergence:-0.007
MFE 1 (kcal):-150.9MFE 2 (kcal):-141.9MFE divergence-0.031