Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20270-AT4G28730
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Thioredoxin superfamily protein
Function (paralog2):Glutaredoxin family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.7440678511882
Log2 mRNA fold difference:-0.89129682060111
Log2 TE fold difference:-0.85989577054503
Sequences
Protein sequence

MVAATVNLANMTWTSLNSNPAISFSMLSGIRNLGMLPFRRCLKPTVIGIASWPPLRCSSV
KAMSSSSSSSGSTLEETVKTTVAENPVVVYSKTWCSYSSQVKSLFKSLQVEPLVVELDQL
VSLGKTSLPHDIGLKHLQKFWWFLAFPGSEGSQLQNVLEKITGQYTVPNVFIGGKHIGGC
SDTLQLHNKGELEAILAEANGKNGQT

MAVTAFNTLKLVSSSLDPIPSVSCSSYSFSLIYVGSPYKRCLKQSCSVRAMTSSSSAASS
SSSSFGSRMEESIRKTVTENTVVIYSKTWCSYCTEVKTLFKRLGVQPLVVELDQLGPQGP
QLQKVLERLTGQHTVPNVFVCGKHIGGCTDTVKLNRKGDLELMLAEANGKNGQS

www.000webhost.com

Other information
Ka divergence:-0.127084KaKs divergence:0.533139
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):621Length 2 (bp):525Length divergence:-0.084
MFE 1 (kcal):-178.1MFE 2 (kcal):-154.15MFE divergence-0.072