Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20290-AT4G28710
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):myosin-like protein XIG
Function (paralog2):Myosin family protein with Dil domain

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.8825642487281
Log2 mRNA fold difference:2.0251805879307
Log2 TE fold difference:-0.13935515704129
Sequences
Protein sequence

MVFKVFSFVAFMACSTVKVGSIVWVQDPEEAWIDGEVVEVNGEDIKVQCTSGKTVVAKGS
NTYPKDMEVPPSGVDDMTTLAYLHEPGVLQNLKSRYYIDEIYTYTGNILIAVNPFKQLPN
LYNDHMMAQYKGAALGELSPHPFAVADAAYRQMINEGISQSILVSGESGAGKTETAKMLM
KYLAKMGGRAVSDRRTVEDQVLESNPVLEAFGNAKTVKNNNSSRFGKFVEIQFDQRGRIS
GAAIRTYLLERSRVCQVSDPERNYHCFYMLCAAPPEDKRKLKLNDPTEFRYLNQSHCIKL
DGVDDSKEYTKTREAMGIVGINLEEQEAIFRVVAAILHLGNIEFAIGEEPDSSVPTDESK
KYLKIAAELFMCDEQALEDSLCKRIMVTPEETISRCLDPNSAALSRDALAKFVYSRLFDW
IVNKINNSIGQDPDSKDMIGVLDIYGFESFKTNSFEQFCINLTNEKLQQHFTQHVLKMEQ
EEYTKEEIEWSQITFPDNRYVLELIEKKRGGIIALLDEACMFPRSTHKTFSQKLYETLKD
NKYFSKPKLSRTDFTICHYAGDVTYQTEQFLEKNKDYVVAEHQALLGASRCTFIAGLFPP
LVEDANKQSKFSSIASQFKQQLASLIEGLNTTEPHYIRCVKPNNLLKPSIFENQNSLQQL
RCGGVMETIRVCRAGYPTRKHFDEFLDRFGILDSATLDKSSDEKAACKKLLETVGLNGFQ
IGKTKVFLKAGQMAELDDRRTEVLGRAACIIQWKFRSYLTRQSFIMLRNAAINIQAVYRG
QVARYRFENLRREAAALKIQRALRIHLDRKRSYIEAVVTVQSGLRGMAARVVLRRKTKAT
TVIQSHCRRLRAELHYKKLKKAAITTQSAWRARLARKELRKLKTDARDTVVLQAAKSMLA
EKVEELTWRLDLEKRMRVDMEVSKAQENAKLQLALEEIQLQFEETKVSLLKEVEAAKKTA
AIVPVVKEVPVVDTVLMEKLTSENEKLKSLVTSLELKIDETEKKFEETKKISEERLKKAL
DAENKIDNLKTAMHNLEEKLKEVKLENNFLKESVLTTPVKTASGRFLSTPLKNLQNGLFT
SEESQLSGAEFTTPPRIQESGSDTKSRGSHIDPQHEDVDALINSVTKNVGFSQGKPVAAF
TIYKCLLHWKSFEAERTNVFDRLVQMIGSAIKDEDNDANLAYWLSNTSTLLFMLQQSLKS
GGTGATPLRQSPSLVRWMTKGFRSPAAEAIRPVDAKDPALHFKQQLEAYVEKILGIIWDN
LKKELNTVLALCIQAPKTFKGNALISITTANYWQDIIEGLDALLSTLKESFVPPVLIQKI
FSQAFSLINVQVCNSLVTRPDNCSFINGEYLKSGLEKLEKWCCETKEEYAGSSWDELKHT
RQAVGFLLIHKKYNISYDEIANDLCPNLQIQQHFKLCTLYKDEIYNTKSVSQDVIASMTG
VMTDSSDFLLKEDSSNIISLSIDDLCSSMQDKDFAQVKPAEELLENPSFIFLH

MACTTVNVGSCVWVEDPEVAWIDGEVIEVKGSDIKVKCTSGKTVAIKVSSAYPKDVEAPA
SGVDDMTRLAYLHEPGVLQNMKSRFDINEIYTYTGNILIAVNPFRRLPHLYNNHMMQQYK
GAGFGELSPHPFAVADAAYRQMKNQGISQSILVSGESGAGKTETTKLLMQYLADMGGRAV
SEGRTVEKKVLESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDQRGRISGAAIRTYLLER
SRVCQVSDPERNYHCFYMLCAAPPEDIKKWKLADPRKFHYLNQSQCIELERMDDAKEYRE
TRKAMDVVGINSEEQEAIFQVVAAILHLGNVEFGKGKEADSSAPKDDTSNYHLKTAAELF
MCDEQALEDSLCKRVIVTRGETITKCLDQESAALSRDALAKTVYSRLFDWIVNKINDSIG
QDPDSEYLIGVLDIYGFESFKTNSFEQFCINLTNEKLQQHFNQHVFKMEQDEYNKEEIDW
SYIEFVDNQEILDLIEKKAGGIISLLNEACMFPRATHETFAEKMYQTFKDHKHFSKPKLS
RTDFTICHYAGDVTYQTEQFLEKNKDYVVAEHQTLLNASRCAFVASLFPLLAEDANKKSK
FSSISSRFKQQLVTLLETLSTTEPHYIRCVKPNNLLKPLIFENQNVLQQLRCGGVMEAIR
ISCAGFPTRKKFEEFLERFSVLAPEVLDKSTDGWPLSSTDDVACKKLLEKVALQGYQIGK
TKVFLRAGQMADLDARRNEVLGRAASRIQRKFRSYLSRKTFLMLRKVATNMQAVCRGQLS
RLIFEGLRRDAAVLEIQRDIRMHLARKSYKELYFAAVSIQLGIRGMASRGRLRFQRQDKA
AIMIQSHCRKFLAQLHYQRLKKAAITTQSAWRARLARKELRKLKMAAKETGVLEAAKSKL
EKQVEELTWKLQLEKRMRTDMEESKTQENAKLRSALEEMQLQFKETKALHLQEVEAAKKM
AETVPVLQEVPVVDTELVEKLTSENEKLKSLVSSLDQKIDETEKKFEERSKINEERLKQA
IEAETTIVNLKTAVHELQEKILDVESENKILRQKSLIQASGHLPPTPVKGSQNGHFSSKE
SPFNGSEIETLARTQEQESDAKTRRYHLDRQRENIGALINCVVNNIGFNQGKPVAAFTIY
KCLLHWKSFEAERTSVFDRLVQMIGSAIKDEGDNEHLAYWLSNTSTLLFMIQQSLKPGAT
PQQKTPVSTSLFGRMAMGFRSAPSSAETSAAAEAAAAAVIRPVVAKDPALLFKQQLTAYV
EKIFGMIRDNLKNELQTLLSLCIQAPRTSTGRSLRSFRSSKTMRNNSPLDHWNGIYDGLN
AILSTLQENFVPPVLIQNIFIQTFSFINVQLFNSLLLRRECCTFSNGEFVKSGLALLEEW
CNETTEEYAGSSWDELKHIRQAVGFMVIHKKYRISYDDIAHDLCPILSVQQLYRICTLYW
DDSYNTRSVSQDVIANMRVLMTEDSNNADSSAFLLDEDSSIPFSADDLSSSMKEKDFAEM
KPAEELEENPAFSFLI

www.000webhost.com

Other information
Ka divergence:-0.288764KaKs divergence:-0.388786
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):4482Length 2 (bp):4551Length divergence:0.008
MFE 1 (kcal):-1270.89MFE 2 (kcal):-1325.16MFE divergence0.021