Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20310-AT4G28690
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RPM1 interacting protein 13
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-2.1786670699053
Log2 mRNA fold difference:-1.3992875424503
Log2 TE fold difference:-0.74581785812825
Sequences
Protein sequence

MGSGNHVDIVDVSSGEEDVDTRGDVEYTDWLNGVMEPVDDTSDSTDIVEVLSEVRGGVNS
QYRKPNSSNQALEDDDDCVILDCDPDKTRETTSVDDDDDDDVLVVGQKGEIACRDFPHPR
HSCAKYAFNSTSHEKYCDMCHCYVCDIRAPCPYWCIAVSSIDHCHANDKEKIWKNQREYF
RTGYMPTAPSSKPTPSILRVPKNTLLRKNHVEIRPCSSSTRVANPSSVKARHRIRQPIPH
NQGLQSQPAQSLSTVRDSVIQKDRSSYRFSLRSRVASSAGNGISIRFNNAQVSQSSHHSS
STVAPTLNPETYTQQRNVRDHCTALPGSQSNVFTRHADQNIRGSGNRQFQTNVDRFAPSK
APLTAEDSHTATVQQQPGINENVLETKLSEFEKWLMENPNPTGPVSPLPEPGNQDYASTL
SFDFETFLND

MSSMNHIVVDVSSDEDDDKPVDYSYLLDRILGVSDEKKPIKGTVLLNPTVENEDDDDDCV
ILDFDPTAKETVIETCETDGVLVVGQKGEVACRDFPHPRHACAKYPFKSTLHQTFCEMCH
CYVCDTRAPCTYWFSGGISNTDHCHANDKEKTWNDQRECIRTGNMLPRPVSKPASAKLQF
KRAPRRPSVYVPVPLLQNSSGTNLGIRACSKSTKVAIHPKTYTRPGHRTEQSRTVQQNPG
SQPHAMQSLPNHKSGSNNGNPSPQVVPSNPYVLTRRPSNGVYPPENSVQNISQGLQPTYY
APLMASQGSQPTRFAPPVASQGSQPTCCAPPVASQGSQPTRYAPPVASQGNAQRIVTGSI
STVPVSQSKEAKQFSRNMYSANVQTNAVPTMTPNPPAVQQQQQQQSGRSNDRVLSEFEDW
LLDDSTLPCPSSVQDNTLKIDFETFLND

www.000webhost.com

Other information
Ka divergence:0.212644KaKs divergence:0.330665
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1293Length 2 (bp):1347Length divergence:0.02
MFE 1 (kcal):-377.67MFE 2 (kcal):-369.67MFE divergence-0.011