Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G20400-AT4G28610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):myb-like HTH transcriptional regulator family protein
Function (paralog2):phosphate starvation response 1

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.4490968128873
Log2 mRNA fold difference:2.7548523033947
Log2 TE fold difference:-0.31230801883633
Sequences
Protein sequence

MIPNDDDDANSMKNYPLNDDDANSMKNYPLNDDDANSMENYPLRSIPTELSHTCSLIPPS
LPNPSEAAADMSFNSELNQIMARPCDMLPANGGAVGHNPFLEPGFNCPETTDWIPSPLPH
IYFPSGSPNLIMEDGVIDEIHKQSDLPLWYDDLITTDEDPLMSSILGDLLLDTNFNSASK
VQQPSMQSQIQQPQAVLQQPSSCVELRPLDRTVSSNSNNNSNSNNAAAAAKGRMRWTPEL
HEVFVDAVNQLGGSNEATPKGVLKHMKVEGLTIFHVKSHLQKYRTAKYIPVPSEGSPEAR
LTPLEQITSDDTKRGIDITETLRIQMEHQKKLHEQLESLRTMQLRIEEQGKALLMMIEKQ
NMGFGGPEQGEKTSAKTPENGSEESESPRPKRPRNEE

MEARPVHRSGSRDLTRTSSIPSTQKPSPVEDSFMRSDNNSQLMSRPLGQTYHLLSSSNGG
AVGHICSSSSSGFATNLHYSTMVSHEKQQHYTGSSSNNAVQTPSNNDSAWCHDSLPGGFL
DFHETNPAIQNNCQIEDGGIAAAFDDIQKRSDWHEWADHLITDDDPLMSTNWNDLLLETN
SNSDSKDQKTLQIPQPQIVQQQPSPSVELRPVSTTSSNSNNGTGKARMRWTPELHEAFVE
AVNSLGGSERATPKGVLKIMKVEGLTIYHVKSHLQKYRTARYRPEPSETGSPERKLTPLE
HITSLDLKGGIGITEALRLQMEVQKQLHEQLEIQRNLQLRIEEQGKYLQMMFEKQNSGLT
KGTASTSDSAAKSEQEDKKTADSKEVPEEETRKCEELESPQPKRPKIDN

www.000webhost.com

Other information
Ka divergence:-0.560214KaKs divergence:-0.563899
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1194Length 2 (bp):1230Length divergence:0.015
MFE 1 (kcal):-315.4MFE 2 (kcal):-349.5MFE divergence0.051